DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and GC2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:293 Identity:78/293 - (26%)
Similarity:122/293 - (41%) Gaps:59/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQ-----GQKIDQSFSQLRYRGMTDAFVKISREEGLRALY 70
            :.||||.|......:|:|..|||||.|     |:::        |..:.|.|.|....||...:|
  Fly    25 INGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERM--------YTSIADCFRKTIASEGYFGMY 81

  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANE--RGLLINEDGSERVWSNILCAAAAGAISSAIANP 133
            .|        :....:.......:|..||:  |..|.::||...:....|....||.....:..|
  Fly    82 RG--------SAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTP 138

  Fly   134 TDVLKVRMQVHGK--------GQHKGLLGCFG---EIYKYEGVRGLWRGVGPTAQRAVVIASVEL 187
            .::||::||..|:        |:....:...|   .:.:..|:.||::|||.|..|.:..:.|..
  Fly   139 MELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYF 203

  Fly   188 PVYDFCKLQ---LMNAFGDHVGNHFISSFIASLGSAIAS----TPIDVIRTRLMNQRPVSITMNG 245
            |:..:...|   ..:..|:.|   |..|.||.|.|.:.|    ||.||::|||.           
  Fly   204 PLMAWINDQGPRKSDGSGEAV---FYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ----------- 254

  Fly   246 VVTAAATPKLYSGSLDCAVQTIRNEGLPALYKG 278
                |...|.:.|.:||..:|::.||:.|.:||
  Fly   255 ----ADGEKKFKGIMDCVNRTLKEEGISAFFKG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 23/90 (26%)
Mito_carr <132..199 CDD:278578 19/80 (24%)
Mito_carr 204..303 CDD:278578 26/79 (33%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 78/293 (27%)
Mito_carr 16..106 CDD:278578 25/96 (26%)
Mito_carr 123..203 CDD:278578 20/79 (25%)
Mito_carr 228..302 CDD:278578 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.