DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and GC1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:300 Identity:82/300 - (27%)
Similarity:130/300 - (43%) Gaps:49/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75
            :.||:|.|......||:|..||||  |.|:|..:..:: |..|.|.|.|..:.||...:|.|...
  Fly    26 INGGIAGIIGVTCVFPLDLVKTRL--QNQQIGPNGERM-YNSMFDCFRKTYKAEGYFGMYRGSGV 87

  Fly    76 AVLRQATYGTIKFGTYYTLKKLANE--RGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLK 138
            .:|.......||.        .||:  |..|..:||...:.|.::....|||....:..|.::||
  Fly    88 NILLITPEKAIKL--------TANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLK 144

  Fly   139 VRMQVHGKGQHKGLLG-----------CFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDF 192
            ::||..|:......|.           ...::.|.:|:.||::|:|.|..|.|..:.:..|::  
  Fly   145 IQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLF-- 207

  Fly   193 CKLQLMNAFG----DHVGNH-FISSFIASLG----SAIASTPIDVIRTRLMNQRPVSITMNGVVT 248
               ..:|..|    |..|.. |..||:|.|.    :|:|..|.||::|||.           .:.
  Fly   208 ---ATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQ-----------AIK 258

  Fly   249 AAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGP 288
            .|...|.:.|..||..:|:::||..|.:||.:...:.:.|
  Fly   259 KADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 26/85 (31%)
Mito_carr <132..199 CDD:278578 17/77 (22%)
Mito_carr 204..303 CDD:278578 25/89 (28%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 26/87 (30%)
Mito_carr 115..213 CDD:278578 23/102 (23%)
Mito_carr 226..307 CDD:278578 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.