DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Tpc1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:319 Identity:82/319 - (25%)
Similarity:132/319 - (41%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQ-------LRYRGMTDAFVKISREEGLRALY 70
            ||:::........|:|..|.|.|:|.:.:.::.::       .:|..:..|...|.||||:.|.:
  Fly    35 GGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFW 99

  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTD 135
            .|..||.:....||..:|.||..|..:|.:...|    ...:..||.||.||||..:..|:.|.|
  Fly   100 KGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYL----ADHQHLSNFLCGAAAGGAAVIISTPLD 160

  Fly   136 VLKVRM--QVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVI--------------AS 184
            |::.|:  |...|| ::........|.:.||.||::||:.....:...:              |.
  Fly   161 VIRTRLIAQDTSKG-YRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWAC 224

  Fly   185 VELPVYDFCKLQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLM------NQRPVSITM 243
            ..|.|.|..:|......|....:..:|..|.        .|.|:|:.||.      |::....|:
  Fly   225 AFLEVSDRSQLPTWTLLGLGASSGMLSKTIV--------YPFDLIKKRLQIQGFESNRQTFGQTL 281

  Fly   244 NGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            .           ..|..||...|:|.||:..||||..||.::......::|..|::||:
  Fly   282 Q-----------CHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 25/90 (28%)
Mito_carr <132..199 CDD:278578 19/82 (23%)
Mito_carr 204..303 CDD:278578 26/105 (25%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/87 (28%)
PTZ00169 33..329 CDD:240302 81/317 (26%)
Mito_carr 153..222 CDD:278578 15/69 (22%)
Mito_carr 233..328 CDD:278578 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.