DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and CG16736

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:318 Identity:61/318 - (19%)
Similarity:111/318 - (34%) Gaps:74/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGI 73
            |...|.:...||:..:.|::.  .|:.:|...|..|...:.:      ..::....||...|.||
  Fly     2 PVYVGLLIKTTAQLLSHPMEL--VRVNMQANVIHHSRLSINH------MFRLMARHGLPGFYYGI 58

  Fly    74 WPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERV------WSNILCAAAAGAISSAIAN 132
            ..|.||...:....:..:|.|:.  |:..|::....:..|      |..:|....|   ..|:..
  Fly    59 VAACLRCTVHTMSTYTLFYNLQD--NKYVLMLQPYNTSMVLGITGFWGGVLATPFA---KLAVIR 118

  Fly   133 PTDVLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGV-------GPT---------AQRAVV 181
            ..|:.:                  |. |:....|..|||:       |.|         :..:..
  Fly   119 QADLTR------------------GS-YERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTA 164

  Fly   182 IASVELPVYDFCKLQLMNAFGDHVGNHFISSFI--ASLGSAIA--STPIDVIRTRLMNQRPVSIT 242
            :|.:..|:.|  |:..:.::...:...::|..|  |..||.|.  .||:|.:.|..:|:      
  Fly   165 VAVLYTPISD--KVHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNE------ 221

  Fly   243 MNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQL 300
             :......:.|.||.       :.||..|....:.|:.|..:.:.|..::....|..|
  Fly   222 -SSHYGRTSYPYLYR-------KIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRFL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 19/87 (22%)
Mito_carr <132..199 CDD:278578 13/82 (16%)
Mito_carr 204..303 CDD:278578 22/101 (22%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/82 (22%)
Mito_carr 187..277 CDD:278578 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.