DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and CG6893

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:301 Identity:75/301 - (24%)
Similarity:127/301 - (42%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAV 77
            ||||...|:..|.|.|..:.|:.:  .|.|        |||.....:..|..|..:||.|:...:
  Fly    21 GGVAGAIAQCFTAPFDLIEARMVV--IKKD--------RGMASNLQQAIRTHGFISLYDGLSAQL 75

  Fly    78 LRQATYGTIKFGTYYTLKK-LANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRM 141
            |||.||.:::|..|...|: |.:..|||          ..:|.||.||.::..:..|.:::..||
  Fly    76 LRQLTYTSMRFHLYEMGKEHL
DDPAGLL----------DKVLVAALAGCVAGVVGTPMELINTRM 130

  Fly   142 QVH------GKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNA 200
            ||:      .:..::.:......:.:.||...|:.|...:..|:.:|...:...||..| |:...
  Fly   131 QVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAK-QIYAE 194

  Fly   201 F----GDHVGNHFISSFIASLGSAIASTPIDVIR-TRLMNQRPVSITMNGVVTAAATPKLYSGSL 260
            |    .|:...|.|||..|:........||:.:| .|:::.|                     .|
  Fly   195 FFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSR---------------------RL 238

  Fly   261 DCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLK 301
            ..::..:...|....::|.:|..:||.|..:|.|:::|||:
  Fly   239 INSISYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 27/84 (32%)
Mito_carr <132..199 CDD:278578 15/72 (21%)
Mito_carr 204..303 CDD:278578 22/99 (22%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 27/84 (32%)
Mito_carr 98..192 CDD:395101 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.