DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and slc25a30

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001165746.1 Gene:slc25a30 / 394840 XenbaseID:XB-GENE-995074 Length:291 Species:Xenopus tropicalis


Alignment Length:299 Identity:166/299 - (55%)
Similarity:207/299 - (69%) Gaps:17/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALY 70
            :|:||:|||:||||||.||||||.||||||:|||..|..:.::|||||..|.|:|.:|||::|||
 Frog     5 NWKPFIYGGLASITAECGTFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIWKEEGVKALY 69

  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTD 135
            |||.||:||||:|||||.|||.:||:      |.::....|.:..|:.|...:|.:||.||||||
 Frog    70 SGIAPAMLRQASYGTIKIGTYQSLKR------LFVDCPEDETLVINVFCGVLSGVVSSCIANPTD 128

  Fly   136 VLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK--LQLM 198
            |||:|||..|.....|::|.|..||:.||.||||:||..|||||.::..|||||||..|  |.|.
 Frog   129 VLKIRMQAQGSLIQGGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   199 NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263
            ...||.|..||::||...|..|:||.|:||:|||:||||.:....|         ..|.|:|||.
 Frog   194 GLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSIRNVSN---------SSYKGTLDCL 249

  Fly   264 VQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            :||.:|||..||||||.|.|:|:||||||||||||||||
 Frog   250 LQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 61/89 (69%)
Mito_carr <132..199 CDD:278578 39/68 (57%)
Mito_carr 204..303 CDD:278578 55/99 (56%)
slc25a30NP_001165746.1 Solcar 1 7..96 60/94 (64%)
PTZ00169 9..289 CDD:240302 164/295 (56%)
Solcar 2 104..189 45/84 (54%)
Solcar 3 198..289 56/100 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4972
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57046
Inparanoid 1 1.050 329 1.000 Inparanoid score I2414
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 1 1.000 - - FOG0005838
OrthoInspector 1 1.000 - - oto105204
Panther 1 1.100 - - LDO PTHR45618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 1 1.000 - - X4231
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.