DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and ucp2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_989179.1 Gene:ucp2 / 394786 XenbaseID:XB-GENE-1010081 Length:307 Species:Xenopus tropicalis


Alignment Length:301 Identity:101/301 - (33%)
Similarity:165/301 - (54%) Gaps:31/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74
            ||..|.|:..|:..|||:||.|.||||||:....:....:|:|:......:.:.||.::||:|:.
 Frog    17 FVGAGTAACIADLFTFPLDTAKVRLQIQGENKVVNVKAAQYKGVFGTISTMVKTEGPKSLYNGLV 81

  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERV--WSNILCAAAAGAISSAIANPTDVL 137
            ..:.||.::.:::.|.|.::|:...:        |||.|  .|.:......||::.|:|.||||:
 Frog    82 AGLQRQMSFASVRIGLYDSVKQFYTK
--------GSEHVGIGSRLAAGCTTGAMAVAVAQPTDVV 138

  Fly   138 KVRMQVHGKG----QHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLM 198
            |||.|.....    ::||.:..:..|.:.||:||||:|..|...|..::...||..||..|..|:
 Frog   139 KVRFQAQANSSANRRYKGTMHAYRTIAREEGMRGLWKGTAPNITRNAIVNCTELVTYDIIKDSLL 203

  Fly   199 --NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLD 261
              |...|::..||.|:|.|...:.:.::|:||::||.||               :....|:.:::
 Frog   204 K
ANIMTDNLPCHFTSAFGAGFCTTVIASPVDVVKTRYMN---------------SAKGQYASAIN 253

  Fly   262 CAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            ||:...|.||..|.||||:|:::|:|.||::.|:||||||:
 Frog   254 CALTMFRKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 29/86 (34%)
Mito_carr <132..199 CDD:278578 26/72 (36%)
Mito_carr 204..303 CDD:278578 35/99 (35%)
ucp2NP_989179.1 Mito_carr 11..107 CDD:365909 29/89 (33%)
Mito_carr 112..204 CDD:365909 32/91 (35%)
Mito_carr 211..297 CDD:365909 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.