DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and slc25a10b

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_957466.1 Gene:slc25a10b / 394147 ZFINID:ZDB-GENE-040426-1095 Length:286 Species:Danio rerio


Alignment Length:300 Identity:88/300 - (29%)
Similarity:139/300 - (46%) Gaps:39/300 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPA 76
            :||:||..|...|.|:|..|..||.| |::     ::|..||.   :.:.:.:|..|||||:..:
Zfish    11 FGGIASCGAACCTHPLDLIKVHLQTQ-QEV-----KMRMMGMA---IHVVKNDGFLALYSGLSAS 66

  Fly    77 VLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRM 141
            :.||.:|...:|..|.|::.....     ...|....:..:|..|..|.....|..|.|::.|||
Zfish    67 LCRQMSYSLTRFAIYETVRDTLGS-----GSQGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVRM 126

  Fly   142 Q------VHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNA 200
            |      :..:..:|..|.....:::.||.|.|:.|....:.|..::...:|..||..|..::..
Zfish   127 QNDVKLPLEQRRNYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAKQLVLGT 191

  Fly   201 --FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263
              .||::..||:|||||...:.....|:||::|||||.:..                |.|.:.|.
Zfish   192 GLMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE----------------YRGVMHCL 240

  Fly   264 VQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            .:|.: .|..|.|||.:|..:|:.|..|:.|:..||||||
Zfish   241 SETAK-LGPLAFYKGLVPAGIRLIPHTILTFVFLEQLKKY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 28/84 (33%)
Mito_carr <132..199 CDD:278578 18/72 (25%)
Mito_carr 204..303 CDD:278578 33/98 (34%)
slc25a10bNP_957466.1 PTZ00169 12..278 CDD:240302 85/296 (29%)
Mito_carr 12..92 CDD:278578 28/93 (30%)
Mito_carr <118..190 CDD:278578 18/71 (25%)
Mito_carr 197..281 CDD:278578 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.