DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and slc25a27

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:306 Identity:116/306 - (37%)
Similarity:167/306 - (54%) Gaps:26/306 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQ----KIDQSFSQLRYRGMTDAFVKISREEGLRALY 70
            |.....|:..||..|||:|.|||||||||:    |...|....:||||......|.||||...|:
Zfish    16 FTLSACAAAVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLSTAAGIVREEGPLKLW 80

  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTD 135
            .|:.||:.|...|...:...|..::    |..|..:|||...||..::.:..:||:...||:|||
Zfish    81 QGVTPAIYRHIVYSGGRMLAYEQMR----ESVLGKSEDGIFPVWKAVIASMISGALGQFIASPTD 141

  Fly   136 VLKVRMQVHGK-------GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFC 193
            ::||:||:.|:       .:.:|:...|.:|....|:||||.|..|..|||.::...:|..||..
Zfish   142 LVKVQMQMEGRRRLEGKPPRVRGVYHAFTKIVAQGGIRGLWAGWVPNVQRAALVNLGDLMTYDTV 206

  Fly   194 KLQLM--NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLY 256
            |..|:  .:..|:...|.:||..:.|.:|...||.||::||:||| |......|:        ||
Zfish   207 KHFLLRNTSIPDNSICHGLSSICSGLVAATMGTPADVVKTRVMNQ-PRDSNGRGL--------LY 262

  Fly   257 SGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            ..|.||.||::|.||..:|||||:|||.||.||::.|::|:|||::
Zfish   263 RNSTDCLVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQLRR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 35/90 (39%)
Mito_carr <132..199 CDD:278578 26/75 (35%)
Mito_carr 204..303 CDD:278578 43/99 (43%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 37/99 (37%)
PTZ00169 16..310 CDD:240302 116/306 (38%)
Mito_carr 118..213 CDD:278578 32/94 (34%)
Mito_carr 217..311 CDD:278578 44/101 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.