DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a34

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_006539059.1 Gene:Slc25a34 / 384071 MGIID:2686215 Length:333 Species:Mus musculus


Alignment Length:324 Identity:92/324 - (28%)
Similarity:145/324 - (44%) Gaps:57/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75
            |.|..|...|...|.|::..|||||:||:..........|||...:...::|.:||..|..|:..
Mouse    25 VLGASACCLACVFTNPLEVVKTRLQLQGELQAPGTYPRPYRGFVSSVAAVARADGLWGLQKGLAA 89

  Fly    76 AVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDV---- 136
            .:|.|.....::|..|    .||.:.||.....|:      ::..|||||:.:.:.:|..:    
Mouse    90 GLLYQGLMNGVRFYCY
----SLACQAGLTQQPGGT------VVAGAAAGALGAFVGSPAYLFPGS 144

  Fly   137 ---------LKVRMQVHG----------KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVI 182
                     |:|:.|:..          :.||:|:|.....|::.:|:.|||||||....|..|.
Mouse   145 ILELPSALNLQVKTQLQAQTVATMAVGHQHQHQGVLSALETIWRQQGMLGLWRGVGGAVPRVTVG 209

  Fly   183 ASVELPVYDFCKLQLMNAFGDHVGNHFI---------SSFIASLGSAIASTPIDVIRTRLMNQRP 238
            ::.:|..:...|..:.:.      ..|:         ...|:|:......||:||:.|||.|| |
Mouse   210 SAAQLATFTSAKAWVQDR------QWFLEDSWLVTLAGGMISSIAVVAVMTPLDVVSTRLYNQ-P 267

  Fly   239 VSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            |.        .|...:||.|..||.|:|.:.||..|||||..|.::|:||..|:....:::|:|
Mouse   268 VD--------RAGRGQLYGGLADCLVKTCQQEGPLALYKGLGPAYLRLGPHTILSMFFWDELRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 25/85 (29%)
Mito_carr <132..199 CDD:278578 21/89 (24%)
Mito_carr 204..303 CDD:278578 36/108 (33%)
Slc25a34XP_006539059.1 Mito_carr 18..105 CDD:365909 24/79 (30%)
Mito_carr <156..226 CDD:365909 19/69 (28%)
Mito_carr 234..324 CDD:365909 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.