DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and CG8323

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:303 Identity:93/303 - (30%)
Similarity:148/303 - (48%) Gaps:27/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74
            ||.||:||:.|.|.|.||:..|||:|:||:...:......|:|:.:||:.:::.:|:..|..|:.
  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70

  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139
            ||:..|....:.:...|    ..|.||..:.|..|.......:|..|..|.:....::|..::|.
  Fly    71 PALYFQFIINSFRLSIY----SEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKT 131

  Fly   140 RMQVHGKGQ--------HKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQ 196
            ::|.....|        |..:.....:||...||||||||......||.:.:..::..:...|..
  Fly   132 QLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKAL 196

  Fly   197 LMNAFGDHVGNHFISSFIASL--GS--AIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYS 257
            |:..  |.|....::||.|.|  ||  ::|.||.|||.|||.||.         |.|.....||.
  Fly   197 LVQY--DLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQG---------VDAEGRGLLYR 250

  Fly   258 GSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQL 300
            |.|||.|:.:|:||:..:||||...::|:.|.:.:..:.:::|
  Fly   251 GWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 28/86 (33%)
Mito_carr <132..199 CDD:278578 19/74 (26%)
Mito_carr 204..303 CDD:278578 37/101 (37%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/80 (34%)
PTZ00169 5..293 CDD:240302 92/301 (31%)
Mito_carr 101..200 CDD:278578 23/98 (23%)
Mito_carr 206..301 CDD:278578 36/97 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.