DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and CG8026

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:311 Identity:82/311 - (26%)
Similarity:138/311 - (44%) Gaps:53/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75
            |.|||.|...   ..|:|..|.|..:..   .::.:..:|||::.||..|.|:||.|.||.|:.|
  Fly    30 VSGGVVSTLI---LHPLDLIKIRFAVND---GRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTP 88

  Fly    76 AVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERV----WSNILCAAAAGAISSAIANPTDV 136
            .|....:...:.|..|.|:|...        :.|:..:    ..|:|.||.:|.::..:.||..|
  Fly    89 NVWGSGSSWGLYFMFYNTIKTFI--------QGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWV 145

  Fly   137 LKVRM----QVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQL 197
            :|.|:    ......:::|::...|:|||.||:|||:||..| ....|...:::...|:    :|
  Fly   146 VKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVP-GMLGVSHGAIQFMTYE----EL 205

  Fly   198 MNAFGDH----------VGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAAT 252
            .||:.::          ...:...:.::.|.:|.|:.|..|:|.||.:..               
  Fly   206 KNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHH--------------- 255

  Fly   253 PKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
             ..|:|:.||..||.|.||....|||...:..|:.|..::.|:.||.:..:
  Fly   256 -HRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 28/85 (33%)
Mito_carr <132..199 CDD:278578 21/70 (30%)
Mito_carr 204..303 CDD:278578 25/108 (23%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 77/291 (26%)
Mito_carr 23..115 CDD:278578 28/98 (29%)
Mito_carr 119..213 CDD:278578 28/98 (29%)
Mito_carr 220..307 CDD:278578 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.