DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Ucp4B

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:300 Identity:104/300 - (34%)
Similarity:172/300 - (57%) Gaps:26/300 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLRQ 80
            ::.:||...:|.|..|||:||||:...:...:.:|||:....:.|.|||||..||.||...:.|.
  Fly    46 SACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRH 110

  Fly    81 ATYGTIKFGTYYTLKKLANERGLLINEDGSERV--WSNILCAAAAGAISSAIANPTDVLKVRMQV 143
            :.:..||..||..::    |:.::.:|||..::  ..:.:....|||.:|.:.|||:::|::||:
  Fly   111 SLFSGIKMLTYDYMR----EKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQM 171

  Fly   144 HGKGQHKG-------LLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNAF 201
            .|:.:.:|       :|.....||:..||.|||:|..|...|:.::...::..|||||..|:..|
  Fly   172 EGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEF 236

  Fly   202 GDHVGN---HFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263
             |.|.|   .|:::..|.:..||.|.|.||:::|:||| |......|:        .|.|||||.
  Fly   237 -DLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQ-PTDEQGRGI--------HYKGSLDCL 291

  Fly   264 VQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            .:.:|.||..|:||||||.|:|:||.:::|::|:||::::
  Fly   292 SRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 29/80 (36%)
Mito_carr <132..199 CDD:278578 25/73 (34%)
Mito_carr 204..303 CDD:278578 40/101 (40%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 91/273 (33%)
Mito_carr 32..129 CDD:278578 30/86 (35%)
Mito_carr 138..233 CDD:278578 28/94 (30%)
Mito_carr 246..331 CDD:278578 38/93 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441706
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D64492at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.