DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Rim2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:361 Identity:88/361 - (24%)
Similarity:129/361 - (35%) Gaps:101/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQI------------------------------QGQKIDQSF 45
            :.||.|.......|.|::..|||||.                              |.:|:  |.
  Fly    13 IAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKL--ST 75

  Fly    46 SQLRYR------------------GMTDAFVK----------ISREEGLRALYSGIWPAVLRQAT 82
            :.||.|                  |::....|          |.:.||.|||:.|:.|.::..|.
  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAP 140

  Fly    83 YGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQV-HGK 146
            ...|.|.||...|...|..|.:  |..|..|  :|:.||:||.:||...||...:|.|||: :..
  Fly   141 SRAIYFCTYSQTKNTL
NSLGFV--ERDSPLV--HIMSAASAGFVSSTATNPIWFVKTRMQLDYNS 201

  Fly   147 GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQR-AVVIASVELPVYDFCKLQLM----NAFGDHVG 206
            .....:..|...:|...||...::|:  ||.. .:....|...:|:|.|.:|:    ....|..|
  Fly   202 KVQMTVRQCIERVYAQGGVAAFYKGI--TASYFGICETMVHFVIYEFIKSKLLE
QRNQRHTDTKG 264

  Fly   207 NHFISSFI--ASLGSAIAST---PIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQT 266
            :.....|:  .::...|||.   |.:|.||||..:                    ....:...||
  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREE--------------------GNKYNSFWQT 309

  Fly   267 I----RNEGLPALYKGFIPTWVRMGPWNIIFFITYE 298
            :    :.||...||:|.....||..|...|...|||
  Fly   310 LHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/143 (22%)
Mito_carr <132..199 CDD:278578 18/72 (25%)
Mito_carr 204..303 CDD:278578 25/104 (24%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 32/144 (22%)
Mito_carr 163..253 CDD:278578 28/93 (30%)
Mito_carr 268..355 CDD:278578 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.