DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Ucp4A

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:309 Identity:112/309 - (36%)
Similarity:174/309 - (56%) Gaps:35/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSF--SQLRYRGMTDAFVKISREEGLRALYSG 72
            ::...||:..||..|:|:|.|||||||||:....|.  |.::||||......|:||||...|:.|
  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108

  Fly    73 IWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSER--VWSNILCAAAAGAISSAIANPTD 135
            :.||:.|...|..::..:|..::|       ...::|::.  ||.:.||...|||::..:|:|.|
  Fly   109 VTPALYRHVVYSGVRICSYDLMRK-------EFTQNGTQALPVWKSALCGVTAGAVAQWLASPAD 166

  Fly   136 VLKVRMQVHGKGQHKGLLG----------CFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVY 190
            ::||::|:.|:   :.|:|          .|.:|.:..|::|||:|..|..|||.::...:|..|
  Fly   167 LVKVQIQMEGR---RRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTY 228

  Fly   191 DFCKLQLMN--AFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATP 253
            |..|..:||  ...|....|.::|..|...:||..||.||::||:||| |......|:       
  Fly   229 DTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQ-PTDENGRGL------- 285

  Fly   254 KLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
             ||.||:||..||:..||..||||||:|.|:||.||::.|::::||::|
  Fly   286 -LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 34/88 (39%)
Mito_carr <132..199 CDD:278578 23/76 (30%)
Mito_carr 204..303 CDD:278578 42/99 (42%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 112/309 (36%)
Mito_carr 39..138 CDD:278578 35/100 (35%)
Mito_carr 142..239 CDD:278578 33/99 (33%)
Mito_carr 248..336 CDD:278578 42/95 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441708
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.