DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and sesB

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:314 Identity:86/314 - (27%)
Similarity:141/314 - (44%) Gaps:36/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEVKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFS-QLRYRGMTDAFVKISREE 64
            :|.|||   |..||:::..::....||:..|..||:  |.|.:..| ..:|:||.|.|::|.:|:
  Fly    21 VGFVKD---FAAGGISAAVSKTAVAPIERVKLLLQV--QHISKQISPDKQYKGMVDCFIRIPKEQ 80

  Fly    65 GLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVW----SNILCAAAAGA 125
            |..:.:.|....|:|......:.|......|::     .|...|.:.:.|    .|:....||||
  Fly    81 GFSSFWRGNLANVIRYFPTQALNFAFKDKYKQV-----FLGGVDKNTQFWRYFAGNLASGGAAGA 140

  Fly   126 ISSAIANPTDVLKVRMQVH-GKG---QHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVE 186
            .|.....|.|..:.|:... |||   :..||..|..:|:|.:|:.||:||.|.:.|..::..:..
  Fly   141 TSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAY 205

  Fly   187 LPVYDFCKLQLMNAFGDHVGNHFISSFIASLGSAIA---STPIDVIRTRLMNQRPVSITMNGVVT 248
            ...||..:..|.:.....:   :||..||.:.:.:|   |.|.|.:|.|:|.|       :|   
  Fly   206 FGFYDTARGMLPDPKNTPI---YISWAIAQVVTTVAGIVSYPFDTVRRRMMMQ-------SG--- 257

  Fly   249 AAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            ..||..:|..:|.|.....:.||..|.:||.....:| |.......:.|:::||
  Fly   258 RKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILR-GTGGAFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 24/90 (27%)
Mito_carr <132..199 CDD:278578 21/70 (30%)
Mito_carr 204..303 CDD:278578 28/102 (27%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 28/104 (27%)
PTZ00169 23..312 CDD:240302 85/312 (27%)
Mito_carr 124..220 CDD:278578 28/95 (29%)
Mito_carr 223..312 CDD:278578 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.