DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and SLC25A34

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_997231.1 Gene:SLC25A34 / 284723 HGNCID:27653 Length:304 Species:Homo sapiens


Alignment Length:303 Identity:87/303 - (28%)
Similarity:144/303 - (47%) Gaps:30/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75
            |.|..|...|...|.|::..|||||:||:...:......|.|...:...::|.:||..|..|:..
Human    11 VLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQKGLAA 75

  Fly    76 AVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVR 140
            .:|.|.....::|..|    .||.:.||.....|:      ::..|.|||:.:.:.:|..::|.:
Human    76 GLLYQGLMNGVRFYCY----SLACQA
GLTQQPGGT------VVAGAVAGALGAFVGSPAYLIKTQ 130

  Fly   141 MQ--------VHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQL 197
            :|        |..:..|:.:||....|::.:|:.|||:|||....|.:|.::.:|..:...|..:
Human   131 LQAQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWV 195

  Fly   198 MNAFGDHVGNHFIS---SFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGS 259
            .........:..::   ..|:|:...:..||.||:.|||.|| ||.....|        :||.|.
Human   196 QK
QQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYNQ-PVDTAGRG--------QLYGGL 251

  Fly   260 LDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            .||.|:..|.||..|||||..|.::|:||..|:..:.:::|:|
Human   252 TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 24/85 (28%)
Mito_carr <132..199 CDD:278578 19/74 (26%)
Mito_carr 204..303 CDD:278578 35/102 (34%)
SLC25A34NP_997231.1 Mito_carr 2..91 CDD:278578 23/79 (29%)
Solcar 1 4..97 26/89 (29%)
Solcar 2 101..194 24/98 (24%)
Mito_carr <119..197 CDD:278578 19/77 (25%)
Mito_carr 203..295 CDD:278578 35/101 (35%)
Solcar 3 204..295 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.