DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and oac1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_593169.1 Gene:oac1 / 2541790 PomBaseID:SPAC139.02c Length:320 Species:Schizosaccharomyces pombe


Alignment Length:315 Identity:94/315 - (29%)
Similarity:152/315 - (48%) Gaps:34/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVKDWRP---FVYGGVASITAEFGTFPIDTTKTRLQIQGQ--KIDQSFSQLRYRGMTDAFVKISR 62
            :||...|   |:.||:|:..|...|.|.:..|||.|:|||  |:|.  |:..|:.:..||..|:|
pombe    17 QVKKLGPVSGFLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKLDP--SKRIYKSVGQAFSLIAR 79

  Fly    63 EEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAIS 127
            .||:|.|..|:..|.:.|......:.|.|..:::..|.  ..:::....::..|:...|.:|...
pombe    80 HEGIRGLQRGLGTAYVYQICLNGCRLGFYEPIRRTLNT--WFLDDPKGNKLAINVASGAGSGLCG 142

  Fly   128 SAIANPTDVLKVRMQVHGK----GQ---HKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASV 185
            :...:|..::|.|||.:..    ||   :|.:...|..|.|..||:||:.|......|.|..:||
pombe   143 ALFGSPFFLVKTRMQSYSPKFPVGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILRTVSGSSV 207

  Fly   186 ELPVYDFCK--LQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVT 248
            :||:|::.|  ::..|...:.:..|..:|.::..|........|.:.||:.||:           
pombe   208 QLPIYNWAKRMIEHYNLLEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRMYNQK----------- 261

  Fly   249 AAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITY-EQLKK 302
               ..:||...:||.::|||:||..||||||.....|:.| :.||.:|: ||..|
pombe   262 ---NKELYKNPIDCILKTIRSEGFFALYKGFGAHLARIAP-HTIFCLTFVEQTNK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/94 (34%)
Mito_carr <132..199 CDD:278578 24/75 (32%)
Mito_carr 204..303 CDD:278578 31/100 (31%)
oac1NP_593169.1 PTZ00169 19..295 CDD:240302 85/293 (29%)
Mito_carr 19..117 CDD:278578 33/99 (33%)
Mito_carr 127..223 CDD:278578 27/95 (28%)
Mito_carr 226..316 CDD:278578 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.