DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and SLC25A30

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:262 Identity:147/262 - (56%)
Similarity:180/262 - (68%) Gaps:17/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALY 70
            :|:||||||:||||||.||||||.||||||||||..|..|.::|||||..|.|:|.|||||:|||
Human     5 NWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALY 69

  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTD 135
            |||.||:||||:|||||.|||.:||:|..||    .||  |.:..|::|...:|.|||.||||||
Human    70 SGIAPAMLRQASYGTIKIGTYQSLKRLFIER----PED--ETLPINVICGILSGVISSTIANPTD 128

  Fly   136 VLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK--LQLM 198
            |||:|||........|::|.|..||:.||.||||:||..|||||.::..|||||||..|  |.|.
Human   129 VLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   199 NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263
            ...||.|..||:|||...|..|:||.|:||:|||:||||   :..:|..:.      |:|:|||.
Human   194 GLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQR---VLRDGRCSG------YTGTLDCL 249

  Fly   264 VQ 265
            :|
Human   250 LQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 66/89 (74%)
Mito_carr <132..199 CDD:278578 38/68 (56%)
Mito_carr 204..303 CDD:278578 27/62 (44%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 67/94 (71%)
Mito_carr 102..191 CDD:278578 47/90 (52%)
Mito_carr 199..>252 CDD:278578 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4759
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57046
Inparanoid 1 1.050 334 1.000 Inparanoid score I2417
Isobase 1 0.950 - 0 Normalized mean entropy S1382
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 1 1.000 - - FOG0005838
OrthoInspector 1 1.000 - - otm42110
orthoMCL 1 0.900 - - OOG6_103926
Panther 1 1.100 - - LDO PTHR45618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 1 1.000 - - X4231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.