DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Ucp1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:296 Identity:97/296 - (32%)
Similarity:155/296 - (52%) Gaps:29/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVL 78
            ||::..|:..|||:||.|.||||||:  .|:.|.:||:|:......:::.|||..||||:...:.
  Rat    21 GVSACLADIITFPLDTAKVRLQIQGE--GQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQ 83

  Fly    79 RQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQ- 142
            ||.::.:::.|.|.|:::..:.     ..:....:.|.|......|.::..|..||:|:||||| 
  Rat    84 RQISFASLRIGLYDTVQEYFSS-----GRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQA 143

  Fly   143 ---VHG-KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMN--AF 201
               :|| |.::.|....:..|...|.:..||:|..|...|.|:|...||..||..|..|:|  ..
  Rat   144 QSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHIL 208

  Fly   202 GDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQT 266
            .|.|..|.:|:.:|...:.:.::|:||::||.:|               :.|..|.....||:..
  Rat   209 ADDVPCHLLSALVAGFCTTLLASPVDVVKTRFIN---------------SLPGQYPSVPSCAMTM 258

  Fly   267 IRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            ...||..|.:|||.|:::|:|.||:|.|:.:|||||
  Rat   259 YTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/82 (39%)
Mito_carr <132..199 CDD:278578 27/71 (38%)
Mito_carr 204..303 CDD:278578 32/99 (32%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 32/83 (39%)
Solcar 1 11..102 32/82 (39%)
PTZ00169 21..297 CDD:240302 97/296 (33%)
Mito_carr 110..205 CDD:278578 31/94 (33%)
Solcar 2 111..201 30/89 (34%)
Solcar 3 210..295 33/100 (33%)
Mito_carr 215..300 CDD:278578 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.