DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and slc-25A10

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:312 Identity:98/312 - (31%)
Similarity:151/312 - (48%) Gaps:44/312 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEVKDWR--PFVYGGVASITAEFGTFPIDTTKTRLQIQGQ-KIDQSFSQLRYRGMTDAFVKISR 62
            |.|.|..|  .:.:||||...|...|.|:|..|.:||.|.| |:  :..||.        :||.:
 Worm     1 MAEDKTKRLGRWYFGGVAGAMAACCTHPLDLLKVQLQTQQQGKL--TIGQLS--------LKIYK 55

  Fly    63 EEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAIS 127
            .:|:.|.|:|:..:||||.||.|.:||.|.|:||       .:.:|.....:...|.|..|||..
 Worm    56 NDGILAFYNGVSASVLRQLTYSTTRFGIYETVKK-------QLPQDQPLPFYQKALLAGFAGACG 113

  Fly   128 SAIANPTDVLKVRMQ------VHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVE 186
            ..:..|.|::.||||      :..:..:|..|.....|.:.||...::.|......||:::...:
 Worm   114 GMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQ 178

  Fly   187 LPVYDFCKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTA 249
            |..||..|..|:::  ..|::..||.||..|:..:.:.:.|:||::||:||              
 Worm   179 LSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMMN-------------- 229

  Fly   250 AATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLK 301
             |.|..:.|.|||.:.|.: .|....:|||||.|.|:.|..::.||.:|||:
 Worm   230 -AAPGEFKGILDCFMFTAK-LGPMGFFKGFIPAWARLAPHTVLTFIFFEQLR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 35/92 (38%)
Mito_carr <132..199 CDD:278578 19/72 (26%)
Mito_carr 204..303 CDD:278578 33/98 (34%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 96/308 (31%)
Mito_carr 15..91 CDD:278578 35/92 (38%)
Mito_carr 95..193 CDD:278578 24/97 (25%)
Mito_carr 214..283 CDD:278578 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.