DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and ucp-4

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:297 Identity:103/297 - (34%)
Similarity:167/297 - (56%) Gaps:20/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLRQ 80
            |::.||..|:|:|.|||||||...|..:.       ||......|.|.||..||::|:.||:.|.
 Worm    33 AALVAETVTYPLDITKTRLQIARNKFTKG-------GMVQVTYDIIRREGAMALWTGVAPAITRH 90

  Fly    81 ATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQVHG 145
            ..|..|:.|.|..::.|...:.:    :.|..:|.::||.|.:|.|:...|:|||::||:||:.|
 Worm    91 YIYTGIRMGAYEQIRLLTFNKEV----EKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEG 151

  Fly   146 KG-------QHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNAF-- 201
            ..       ::.|...||..:|:.:|..|||.|..|..|||.::...::..||..|..|::.|  
 Worm   152 LRRLQKQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFEL 216

  Fly   202 GDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQT 266
            .|:...|.::|..|.|.:||.|.|.||::||:|:|....:....:........||.|.:||.::.
 Worm   217 KDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKI 281

  Fly   267 IRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            |:|||..:|||||:|:::||.||::.|:::||:::|:
 Worm   282 IKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIRKW 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/80 (38%)
Mito_carr <132..199 CDD:278578 25/73 (34%)
Mito_carr 204..303 CDD:278578 36/98 (37%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 102/294 (35%)
Mito_carr 22..111 CDD:278578 31/84 (37%)
Mito_carr 115..214 CDD:278578 33/98 (34%)
Mito_carr <240..318 CDD:278578 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.