DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a10

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:312 Identity:93/312 - (29%)
Similarity:150/312 - (48%) Gaps:42/312 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEVKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEG 65
            |.|.:..| :.:||:||..|...|.|:|..|..||.| |::     :||..||.   :::.|.:|
  Rat     1 MAEARTSR-WYFGGLASCGAACCTHPLDLLKVHLQTQ-QEV-----KLRMTGMA---LQVVRTDG 55

  Fly    66 LRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAI 130
            ..|||:|:..::.||.||...:|..|.|::....:     :..|....:|.:|....:|.....:
  Rat    56 FLALYNGLSASLCRQMTYSLTRFAIYETMRDYMTK-----DSQGPLPFYSKVLLGGISGLTGGFV 115

  Fly   131 ANPTDVLKVRMQVHGK---GQHKGLLGCFGEIYKY---EGVRGLWRGVGPTAQRAVVIASVELPV 189
            ..|.|::.||||...|   .|.:........:|:.   ||::.|:.|....:.|..::...:|..
  Rat   116 GTPADLVNVRMQNDMKLPLSQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSC 180

  Fly   190 YDFCKLQLMNAFG---DHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAA 251
            ||..| ||:.:.|   |::..||:|||||...:.....|:||::|||||.:..            
  Rat   181 YDQAK-QLVLSTGYLSDNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE------------ 232

  Fly   252 TPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
                |.|...|||:|.: .|..|.:||.:|..||:.|..::.|:..|||:|:
  Rat   233 ----YQGVFHCAVETAK-LGPQAFFKGLVPAGVRLVPHTVLTFMFLEQLRKH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 31/89 (35%)
Mito_carr <132..199 CDD:278578 20/72 (28%)
Mito_carr 204..303 CDD:278578 33/98 (34%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 30/93 (32%)
Mito_carr 94..189 CDD:395101 24/95 (25%)
Mito_carr 197..283 CDD:395101 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.