DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and SLC25A10

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:333 Identity:81/333 - (24%)
Similarity:128/333 - (38%) Gaps:91/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRA 68
            |..|   .:||:||..|...|.|:|..|..||.| |::     :||..||.   :::.|.:|:.|
Human     7 VSRW---YFGGLASCGAACCTHPLDLLKVHLQTQ-QEV-----KLRMTGMA---LRVVRTDGILA 59

  Fly    69 LYSGIWPAVLRQATYGTIKFGTYYTLK-KLANERGLLINEDGSERVWSNILCAAAAGAISSAIAN 132
            ||||:..::.||.||...:|..|.|:: ::|.      ...|.......:|..:.:|.....:..
Human    60 LYSGLSASLCRQMTYSLTRFAIYETVRDRVAK------GSQGPLPFHEKVLLGSVSGLAGGFVGT 118

  Fly   133 PTDVLKVRMQVHGK---GQHKGLLGCFGEIYKY---EGVRGLWRGVGPTAQRAVVIASVELPVYD 191
            |.|::.||||...|   ||.:........:|:.   ||:|.|:.|....:.|..::...:|    
Human   119 PADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL---- 179

  Fly   192 FCKLQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPV---------SITMNG-- 245
            :|:...      ||.       :.:.|.|..|.  |.::..:..:.|:         |..:.|  
Human   180 YCRWMC------HVP-------VPAPGCAEDSP--DELQGGVSGRFPLRRGDSEARASGLLQGPR 229

  Fly   246 --------------VVTAAATPKLYSGSLDCAVQTIRNEGLPA---------------LYKGFIP 281
                          .|:..||.||:..|   |:.|.|..|..|               |..|..|
Human   230 PSWHPPHPPHRAHFCVSGTATQKLWHQS---AILTSRGNGWAARPDTLGSSKESQAQHLLLGPRP 291

  Fly   282 TWVRMGPW 289
            .|    ||
Human   292 PW----PW 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/90 (36%)
Mito_carr <132..199 CDD:278578 18/72 (25%)
Mito_carr 204..303 CDD:278578 26/126 (21%)
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 32/94 (34%)
Mito_carr 95..179 CDD:278578 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.