DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and slc25a10a

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_002661286.1 Gene:slc25a10a / 100332610 ZFINID:ZDB-GENE-131127-11 Length:288 Species:Danio rerio


Alignment Length:314 Identity:97/314 - (30%)
Similarity:148/314 - (47%) Gaps:54/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRA 68
            |..|   .:||:||..|...|.|:|..|..||.| |::     ::|..||.   |::.|.:|:.|
Zfish     6 VSRW---YFGGIASCAAACCTHPLDLIKVHLQTQ-QEV-----KMRMTGMA---VQVVRSDGVFA 58

  Fly    69 LYSGIWPAVLRQATYGTIKFGTYYTLK-KLANERGLLINEDGSERVWSNILCAAAAGAISSAIAN 132
            ||:|:..::.||.:|...:|..|.|:: ::|::      ..|....:..||.||..|.....|..
Zfish    59 LYNGLSASLCRQMSYSMTRFAIYETVRDQIASQ------NQGPMPFYQKILLAAFGGFTGGFIGT 117

  Fly   133 PTDVLKVRMQ--------VHGKGQH--KGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVEL 187
            |.|::.||||        :.....|  .|||    .:.|.||:|.|:.|....|.|..::...:|
Zfish   118 PADMVNVRMQNDMKLPPVLRRNYAHALDGLL----RVLKEEGIRKLFSGASMAASRGALVTVGQL 178

  Fly   188 PVYDFCKLQLMNAFG---DHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTA 249
            ..||..| ||:...|   |::..||::||||...:.:...|:||::|||||.:..          
Zfish   179 SCYDQAK-QLVLGTGLMTDNIFTHFVASFIAGGCATVLCQPMDVVKTRLMNSKGE---------- 232

  Fly   250 AATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
                  |.|.:.|...| ...|..|.|||.:|..:|:.|..::.||..|||:.|
Zfish   233 ------YRGLIHCLSDT-GKLGPKAFYKGLVPAGIRLIPHTVLTFIFLEQLRLY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/90 (33%)
Mito_carr <132..199 CDD:278578 24/76 (32%)
Mito_carr 204..303 CDD:278578 31/98 (32%)
slc25a10aXP_002661286.1 Mito_carr 12..86 CDD:278578 29/82 (35%)
Mito_carr 94..190 CDD:278578 31/100 (31%)
Mito_carr 195..281 CDD:278578 33/102 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.