powered by:
Protein Alignment Ccdc56 and Coa3
DIOPT Version :9
Sequence 1: | NP_996062.3 |
Gene: | Ccdc56 / 39320 |
FlyBaseID: | FBgn0261353 |
Length: | 87 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080894.1 |
Gene: | Coa3 / 52469 |
MGIID: | 1098757 |
Length: | 108 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 33/73 - (45%) |
Similarity: | 47/73 - (64%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 SAPKLDKAQLQFMKLIEEQNLDRVQK-LKRIRRNNLLTAGALGVSVLAIYGYSIFSVQQEKFLDD 78
|..||..||||||:.:: |.:.|| |.:.|..|::|...:|..|||||||:.:||.||:|||:
Mouse 26 SREKLTPAQLQFMRQVQ---LAQWQKTLPQRRTRNIMTGLGIGALVLAIYGYTFYSVAQERFLDE 87
Fly 79 FEEPKKVS 86
.|:..|.:
Mouse 88 LEDEAKAA 95
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
57 |
1.000 |
Domainoid score |
I10868 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4782 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
57 |
1.000 |
Inparanoid score |
I5422 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006165 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto93133 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_112315 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15642 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4517 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
10 | 9.890 |
|
Return to query results.
Submit another query.