DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and Coa3

DIOPT Version :9

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_080894.1 Gene:Coa3 / 52469 MGIID:1098757 Length:108 Species:Mus musculus


Alignment Length:73 Identity:33/73 - (45%)
Similarity:47/73 - (64%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SAPKLDKAQLQFMKLIEEQNLDRVQK-LKRIRRNNLLTAGALGVSVLAIYGYSIFSVQQEKFLDD 78
            |..||..||||||:.::   |.:.|| |.:.|..|::|...:|..|||||||:.:||.||:|||:
Mouse    26 SREKLTPAQLQFMRQVQ---LAQWQKTLPQRRTRNIMTGLGIGALVLAIYGYTFYSVAQERFLDE 87

  Fly    79 FEEPKKVS 86
            .|:..|.:
Mouse    88 LEDEAKAA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coiled-coil_56 1..86 CDD:286851 33/71 (46%)
Coa3NP_080894.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Coiled-coil_56 9..106 CDD:286851 33/73 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10868
eggNOG 1 0.900 - - E1_KOG4782
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5422
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006165
OrthoInspector 1 1.000 - - oto93133
orthoMCL 1 0.900 - - OOG6_112315
Panther 1 1.100 - - LDO PTHR15642
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4517
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.