DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and Coa3

DIOPT Version :10

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001102517.1 Gene:Coa3 / 498000 RGDID:1564337 Length:108 Species:Rattus norvegicus


Alignment Length:73 Identity:33/73 - (45%)
Similarity:47/73 - (64%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SAPKLDKAQLQFMKLIEEQNLDRVQK-LKRIRRNNLLTAGALGVSVLAIYGYSIFSVQQEKFLDD 78
            |..||..||||||:.::   |.:.|| |.:.|..|::|...:|..|||||||:.:||.||:|||:
  Rat    26 SREKLTPAQLQFMRQVQ---LAQWQKTLPQRRTRNIVTGLGIGALVLAIYGYTFYSVAQERFLDE 87

  Fly    79 FEEPKKVS 86
            .|:..|.:
  Rat    88 LEDEAKAA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coa3_cc 34..82 CDD:462910 23/48 (48%)
Coa3NP_001102517.1 Coa3_cc 45..91 CDD:462910 22/45 (49%)

Return to query results.
Submit another query.