DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and COA3

DIOPT Version :9

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001035521.1 Gene:COA3 / 28958 HGNCID:24990 Length:106 Species:Homo sapiens


Alignment Length:98 Identity:36/98 - (36%)
Similarity:51/98 - (52%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASEQGPKI--KYGESAP----------KLDKAQLQFMKLIEEQNLDRVQKLKRIRRNNLLTAG 53
            |::|..|..:  |.|| ||          ||...||..|:..|.....:|  |.|.|..|::|..
Human     1 MASSGAGDPLDSKRGE-APFAQRIDPTREKLTPEQLHSMRQAELAQWQKV--LPRRRTRNIVTGL 62

  Fly    54 ALGVSVLAIYGYSIFSVQQEKFLDDFEEPKKVS 86
            .:|..|||||||:.:|:.||:|||:.|:..|.:
Human    63 GIGALVLAIYGYTFYSISQERFLDELEDEAKAA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coiled-coil_56 1..86 CDD:286851 36/96 (38%)
COA3NP_001035521.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 10/33 (30%)
Coiled-coil_56 9..91 CDD:286851 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11550
eggNOG 1 0.900 - - E1_KOG4782
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006165
OrthoInspector 1 1.000 - - oto89566
orthoMCL 1 0.900 - - OOG6_112315
Panther 1 1.100 - - LDO PTHR15642
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4517
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.