DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and COA3

DIOPT Version :10

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001035521.1 Gene:COA3 / 28958 HGNCID:24990 Length:106 Species:Homo sapiens


Alignment Length:98 Identity:36/98 - (36%)
Similarity:51/98 - (52%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASEQGPKI--KYGESAP----------KLDKAQLQFMKLIEEQNLDRVQKLKRIRRNNLLTAG 53
            |::|..|..:  |.|| ||          ||...||..|:..|.....:|  |.|.|..|::|..
Human     1 MASSGAGDPLDSKRGE-APFAQRIDPTREKLTPEQLHSMRQAELAQWQKV--LPRRRTRNIVTGL 62

  Fly    54 ALGVSVLAIYGYSIFSVQQEKFLDDFEEPKKVS 86
            .:|..|||||||:.:|:.||:|||:.|:..|.:
Human    63 GIGALVLAIYGYTFYSISQERFLDELEDEAKAA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coa3_cc 34..82 CDD:462910 21/47 (45%)
COA3NP_001035521.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 10/33 (30%)
Coa3_cc 45..91 CDD:462910 21/47 (45%)

Return to query results.
Submit another query.