DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and tam3

DIOPT Version :9

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001343132.1 Gene:tam3 / 14217902 PomBaseID:SPAC1B3.21 Length:69 Species:Schizosaccharomyces pombe


Alignment Length:48 Identity:18/48 - (37%)
Similarity:26/48 - (54%) Gaps:3/48 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KRIRRNNLLTAGALGVSVLAIYGYSIFSVQQEKFLDDFEEP---KKVS 86
            |..||.||:||..||....|.:.||::.|.::.|.|....|   ||::
pombe    13 KPFRRANLITALGLGAFAFATFAYSVYRVHEDTFEDVVMTPELEKKIA 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coiled-coil_56 1..86 CDD:286851 18/46 (39%)
tam3NP_001343132.1 Coiled-coil_56 <16..67 CDD:286851 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006165
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15642
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.