DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and coa3a

DIOPT Version :9

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001108388.2 Gene:coa3a / 100141351 ZFINID:ZDB-GENE-060810-187 Length:99 Species:Danio rerio


Alignment Length:89 Identity:32/89 - (35%)
Similarity:48/89 - (53%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEQGPKIKYGESAPKLD-------KAQLQFMKLIEEQNLDRVQKLKRIRRNNLLTAGALGVSVLA 61
            |.||......:.|.::|       |.||||::.:|.....:  |..::|..|:.|..|:|..||.
Zfish     5 SSQGEPKPEAQFAKRIDPTKEALTKEQLQFIRQVEMAQWKK--KTDKLRGRNVATGLAIGAVVLG 67

  Fly    62 IYGYSIFSVQQEKFLDDFEEPKKV 85
            ||||:.:||.|||.:|:.:|..||
Zfish    68 IYGYTFYSVSQEKIMDEIDEEAKV 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coiled-coil_56 1..86 CDD:286851 32/89 (36%)
coa3aNP_001108388.2 Coiled-coil_56 1..99 CDD:286851 32/89 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11238
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5444
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006165
OrthoInspector 1 1.000 - - otm26078
orthoMCL 1 0.900 - - OOG6_112315
Panther 1 1.100 - - LDO PTHR15642
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4517
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.