DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc56 and ccdc56

DIOPT Version :9

Sequence 1:NP_996062.3 Gene:Ccdc56 / 39320 FlyBaseID:FBgn0261353 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001165768.1 Gene:ccdc56 / 100135386 XenbaseID:XB-GENE-5749774 Length:100 Species:Xenopus tropicalis


Alignment Length:91 Identity:32/91 - (35%)
Similarity:45/91 - (49%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASEQGPK---IKYGE----SAPKLDKAQLQFMKLIEEQNLDRVQKLKRIRRNNLLTAGALGVSVL 60
            |.:..||   .||.:    ...||...|.:||:..|.....:  ...::|..||:|...:|..||
 Frog     2 AEKGSPKESVAKYAQRIDPKREKLSPEQQEFMRKTEMAQWRK--NAGKLRGRNLVTGLVIGGIVL 64

  Fly    61 AIYGYSIFSVQQEKFLDDFEEPKKVS 86
            .||||:.:||.||||||:.|...|.:
 Frog    65 GIYGYTFYSVSQEKFLDELEVEAKAA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc56NP_996062.3 Coiled-coil_56 1..86 CDD:286851 32/89 (36%)
ccdc56NP_001165768.1 Coiled-coil_56 1..100 CDD:286851 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11742
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5283
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006165
OrthoInspector 1 1.000 - - oto103387
Panther 1 1.100 - - LDO PTHR15642
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4517
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.