DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11658 and fbxo25

DIOPT Version :9

Sequence 1:NP_648498.1 Gene:CG11658 / 39319 FlyBaseID:FBgn0036196 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_031757600.1 Gene:fbxo25 / 595094 XenbaseID:XB-GENE-1003978 Length:362 Species:Xenopus tropicalis


Alignment Length:404 Identity:96/404 - (23%)
Similarity:165/404 - (40%) Gaps:99/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFISKDFRSPGETWIKTDGGWER----------------------------SKVLECGGKRKRH 37
            |.|:.:|:||||.:|:|||.||:|                            .|:.....||::.
 Frog     1 MPFLGQDWRSPGWSWMKTDDGWKRCDFYCDYERDDNFNLHLLNVDNPDFYAADKLDVSAQKRRKE 65

  Fly    38 HSEGSSSYQDSDSSEEEAVMPPHYH-----ITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFH 97
            ....::..|:            .||     |....|||..|:..|.||..||||..::.|.:||:
 Frog    66 QFNNTTKCQN------------FYHEKWIYIQKESTRERHGYCTLGEAFNRLDFSSAIWDIRRFN 118

  Fly    98 YICAFLLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEH---IVSQENQ 159
            |:...|.|::...:.||.|:||:....::|::.....:.|.:|.::|.|...|..   |:.||..
 Frog   119 YVVKLLQLIAKSQLTSLSGAAQKNYFNILEKIVQKATEDQYNPRLIRELLQDLSSSLCILIQEVG 183

  Fly   160 KC--------WGKPLGSTYLWKEHMATIKRIQRVASQIEIREPDPEAKPKLHELPEECVREIILC 216
            :|        |...|.:.|.|::.:..::..|.:           :..|.:.:||......|:..
 Frog   184 RCVLVGNINIWISRLETIYSWQQQLMNLQITQHL-----------DGGPTIRDLPLHMQTNIMNR 237

  Fly   217 IADHRDLESAAEAWETMAKLVSEQRIWRELTRFHFNQRQI--HTILDLDKFKQMGEIKDWKQIYH 279
            ..|..|:.:..:...|:..|..::.:|::|.::||.::..  |.|:     .:.|.| |||.::.
 Frog   238 FTDAWDIINLGQVTPTLHVLSEDRLLWQKLCKYHFAEKMFCRHLIV-----SEKGHI-DWKLMFF 296

  Fly   280 QLRRTYGVNDDYQFAEVLALCRSCCCLFW---------PSDGHPCIVDQSPDYKQRLEEAGGQLA 335
            .|::.|...:  |:.:.|..|:.|..|||         ...||||             .|....:
 Frog   297 ALQKFYPTRE--QYGDTLQFCQHCSILFWKDYQLALIFKDTGHPC-------------TANDPAS 346

  Fly   336 LAQPVPPAQFLKYF 349
            ...||.|..|:..|
 Frog   347 CLIPVSPQHFIDLF 360



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4939
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41649
Inparanoid 1 1.050 135 1.000 Inparanoid score I4452
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280011at33208
OrthoFinder 1 1.000 - - FOG0002870
OrthoInspector 1 1.000 - - otm48105
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.