DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11658 and FBXO25

DIOPT Version :9

Sequence 1:NP_648498.1 Gene:CG11658 / 39319 FlyBaseID:FBgn0036196 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_904357.1 Gene:FBXO25 / 26260 HGNCID:13596 Length:367 Species:Homo sapiens


Alignment Length:399 Identity:95/399 - (23%)
Similarity:170/399 - (42%) Gaps:84/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFISKDFRSPGETWIKTDGGWERSKVLECGGKRKRHHSEGSSSYQDSDSSEEEAVMPPHYH--- 62
            |.|:.:|:||||.:||||:.||:|.:  .|..|.:|.::..:.|:....:||:..:.....|   
Human     1 MPFLGQDWRSPGWSWIKTEDGWKRCE--SCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYA 63

  Fly    63 -------------------------ITIRCTREIAGFNGLSEAVKRLDFRRSVRDRKRFHYICAF 102
                                     :....|:|..|:..|.||..||||..:::|.:||:|:...
Human    64 SKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKL 128

  Fly   103 LLLVSNKGIASLPGSAQRQLLQMVEEVASHVNDSQQHPNVLRGLALKLEHI-----------VSQ 156
            |.|::...:.||.|.||:....:::::...|.|...:|.:::.|...|...           |..
Human   129 LQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLV 193

  Fly   157 ENQKCWGKPLGSTYLWKEHMATIKRIQRVASQIEIREPDPEAKPKLHELPEECVREIILCIADHR 221
            .|...|...|.:...|::.:..::..::|.:.:           .|.:||...:..|:...:|..
Human   194 GNINIWICRLETILAWQQQLQDLQMTKQVNNGL-----------TLSDLPLHMLNNILYRFSDGW 247

  Fly   222 DLESAAEAWETMAKLVSEQRIWRELTRFHFNQRQI--HTILDLDKFKQMGEIKDWKQIYHQLRRT 284
            |:.:..:...|:..|..::::|::|.::||.::|.  |.||     .:.|.| :||.:|..|::.
Human   248 DIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLIL-----SEKGHI-EWKLMYFALQKH 306

  Fly   285 YGVNDDYQFAEVLALCRSCCCLFW---------PSDGHPCIVDQSPDYKQRLEEAGGQLALAQPV 340
            |...:  |:.:.|..||.|..|||         ...||||.. ..||            :...||
Human   307 YPAKE--QYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTA-ADPD------------SCFTPV 356

  Fly   341 PPAQFLKYF 349
            .|..|:..|
Human   357 SPQHFIDLF 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11658NP_648498.1 None
FBXO25NP_904357.1 Interaction with beta-actin 1..83 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159290
Domainoid 1 1.000 133 1.000 Domainoid score I5080
eggNOG 1 0.900 - - E1_KOG3926
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41649
Inparanoid 1 1.050 133 1.000 Inparanoid score I4607
Isobase 1 0.950 - 0 Normalized mean entropy S5943
OMA 1 1.010 - - QHG46083
OrthoDB 1 1.010 - - D280011at33208
OrthoFinder 1 1.000 - - FOG0002870
OrthoInspector 1 1.000 - - otm40908
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13123
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3549
SonicParanoid 1 1.000 - - X2229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.