DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and DYNC2I2

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_443076.2 Gene:DYNC2I2 / 89891 HGNCID:28296 Length:536 Species:Homo sapiens


Alignment Length:362 Identity:83/362 - (22%)
Similarity:146/362 - (40%) Gaps:54/362 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VKHLSWSPDGG-IKMAVSHCDMRFQGDKSNQKCNSYIWEVE----NPNEPFLTLEPKVPCVCLEY 220
            |..:||:..|. :..|....|   .||.|..|.....|.::    .|.:|...:|.....:||.:
Human   164 VTSISWNSTGSVVACAYGRLD---HGDWSTLKSFVCAWNLDRRDLRPQQPSAVVEVPSAVLCLAF 225

  Fly   221 NQKDPTSLVSGMYNGQVAAWDTRHGKLPVM--ISEREVCHRDPVNSVLWNNSKSGTEFF---SGG 280
            :...|:.:..|:|:|:|..||....:.|::  ....:..|.|||:.|:|......:..|   |..
Human   226 HPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGHSHRFQVLSVA 290

  Fly   281 SDGQVLWWD-----TRKLTEPLDRLLMDPVKSDDQDLSRS------------YGISVLEYETTIP 328
            :||:||.|.     ..:|||.. .|:|       |.|.||            .|.:.:.:.:..|
Human   291 TDGKVLLWQGIGVGQLQLTEGF-ALVM-------QQLPRSTKLKKHPRGETEVGATAVAFSSFDP 347

  Fly   329 TRFMAGTEMGMLFSCN-RKGKTPTEKI----------QIRMMCHLGPVYAITRNPAFVKNFLTVG 382
            ..|:.|||.|....|: ..|:....::          |.....|.||:|:::.:|.....||:.|
Human   348 RLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAG 412

  Fly   383 -DWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTV 446
             |....::|. .:...:...:.|...|....||..:...|......|.:..:||.:...:|.:.:
Human   413 TDGHVHLYSM-LQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLI 476

  Fly   447 KVC--DEPLYCVRTN-ENGKFVSCGSQLGATFLVEVS 480
            |..  :.|:||:..| :..:.::.|...|...:.::|
Human   477 KQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 83/362 (23%)
WD40 repeat 162..208 CDD:293791 12/50 (24%)
WD40 212..469 CDD:295369 66/293 (23%)
WD40 repeat 215..254 CDD:293791 10/40 (25%)
WD40 repeat 262..304 CDD:293791 15/49 (31%)
WD40 repeat 318..355 CDD:293791 8/47 (17%)
WD40 repeat 365..401 CDD:293791 7/36 (19%)
WD40 repeat 408..433 CDD:293791 5/24 (21%)
DYNC2I2NP_443076.2 DYNLL2 binding. /evidence=ECO:0000269|PubMed:30649997 80..93
WD40 106..516 CDD:225201 83/362 (23%)
DYNLRB1 binding. /evidence=ECO:0000269|PubMed:30649997 106..131
WD40 repeat 164..215 CDD:293791 13/53 (25%)
WD 1. /evidence=ECO:0000255 215..255 11/39 (28%)
WD40 217..515 CDD:295369 69/306 (23%)
WD40 repeat 220..264 CDD:293791 10/43 (23%)
WD 2. /evidence=ECO:0000255 264..308 13/43 (30%)
WD40 repeat 270..325 CDD:293791 18/62 (29%)
WD40 repeat 337..389 CDD:293791 9/51 (18%)
WD 3. /evidence=ECO:0000255 390..430 10/40 (25%)
WD40 repeat 396..432 CDD:293791 7/36 (19%)
WD 4. /evidence=ECO:0000255 433..473 8/39 (21%)
WD40 repeat 438..476 CDD:293791 8/37 (22%)
WD 5. /evidence=ECO:0000255 480..520 7/34 (21%)
WD40 repeat 485..512 CDD:293791 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.