DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and dync2i2

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001099160.1 Gene:dync2i2 / 794361 ZFINID:ZDB-GENE-070928-9 Length:501 Species:Danio rerio


Alignment Length:424 Identity:97/424 - (22%)
Similarity:175/424 - (41%) Gaps:62/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QNNAVNIYENYFENLDPAPLPEPCKSRTVNVYRDPNPIKVPVKHLSWSPDGG-IKMAVSHCDMRF 183
            :|:..:.::.:..|.:.......|..|..:|  |.....:.|..:||:..|. |.......|   
Zfish    90 KNSKSHAFDGFEVNWEEQNESVSCMYRLQHV--DAQEKSLQVTSVSWNCTGSVIACGFGRVD--- 149

  Fly   184 QGDKSNQKCNSYIWEVE----NPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRH 244
            .||.||:|.....|.|:    ||..|.:.::...|.:||.::...|:.:..|:|:|:|..|||..
Zfish   150 DGDWSNEKACVCTWNVDRQNLNPKRPDVIIDVATPVMCLCFHPVRPSVVAGGLYSGEVVVWDTSR 214

  Fly   245 GKLPVMISEREV---CHRDPVNSVLWNNSKSGTEF--FSGGSDGQVLWW----DTRKLTEPLDRL 300
            .: .:::::..:   .||:||..:.|.......||  .|.||.|:||.|    ...||      |
Zfish   215 SQ-DLILAQTGMSADTHREPVYQINWVPGARRGEFSVLSAGSGGRVLLWTIDGSEAKL------L 272

  Fly   301 LMDPVKSDDQDLSRSYGISVLEYETTIPT-----------RFMAGTEMGMLFSCNRKGKTPT--- 351
            |........|.:.:|...|......||..           .|:.|:|.|::..|:...:|..   
Zfish   273 LSSGYALVRQQMPQSGAASKTRGSLTIGVTAVALSPWDLDTFLVGSEGGLVLKCSFSSETAAAVP 337

  Fly   352 ---EKIQIRMMCHL------GPVYAITRNPAFVKNFLTVG-DWCARIWS--EDCRESSIIWTKSS 404
               |.:.:|.....      ||::::..:|.....|::|| |..|.:.|  :.|   .::..:.|
Zfish   338 SDGESVILRAPMQFSFSPRGGPIHSVHFSPFHRNLFVSVGTDGLAHLHSVLQPC---PLLALRVS 399

  Fly   405 SSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTV--KVCDEPLYCVRTN-ENGKFVS 466
            .|.:....||.|:...|......|::..:||.::...||.|:  ....:|.||:..| ::...::
Zfish   400 DSYVFGVRWSPTRPLVFAAVTGQGLVQMFDLGRRSLRPVATIDQNAGGQPAYCLEFNPKHTNLLA 464

  Fly   467 CGSQLGATFLVEVSDNMVMSAKNDKPLLTAMFER 500
            .|:..|:..:.::|..:......:    |||.|:
Zfish   465 VGNADGSVNIWQLSAELTEQGAKE----TAMLEQ 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 87/364 (24%)
WD40 repeat 162..208 CDD:293791 15/50 (30%)
WD40 212..469 CDD:295369 68/294 (23%)
WD40 repeat 215..254 CDD:293791 10/38 (26%)
WD40 repeat 262..304 CDD:293791 15/47 (32%)
WD40 repeat 318..355 CDD:293791 10/53 (19%)
WD40 repeat 365..401 CDD:293791 8/38 (21%)
WD40 repeat 408..433 CDD:293791 5/24 (21%)
dync2i2NP_001099160.1 WD40 66..481 CDD:225201 93/405 (23%)
WD40 repeat 130..180 CDD:293791 15/52 (29%)
WD40 repeat 187..229 CDD:293791 10/42 (24%)
WD40 repeat 235..296 CDD:293791 17/66 (26%)
WD40 repeat 301..338 CDD:293791 6/36 (17%)
WD40 repeat 361..399 CDD:293791 8/40 (20%)
WD40 repeat 403..442 CDD:293791 10/38 (26%)
WD40 repeat 450..477 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.