DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and dic1

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001342791.1 Gene:dic1 / 5802757 PomBaseID:SPBC646.17c Length:544 Species:Schizosaccharomyces pombe


Alignment Length:549 Identity:113/549 - (20%)
Similarity:184/549 - (33%) Gaps:144/549 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LSVANTERATYKSTGITHNEGGWPKDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIH- 119
            |.:.|.|..| .:...::.||  ||.|:   .:|...:..||.|..|...|..:|.....:.:. 
pombe    17 LLLKNKENCT-DAVSSSNKEG--PKQIS---EDQLSNFLCKILKPTNLTPQTYSLESKSSNLVSD 75

  Fly   120 -QNNAVNIYENYFENLDPAPLPEPCKSRTVNVYRDPNPIKVPVKHLSWS--------PDGGIKMA 175
             :....::|::|....:.:. ..|..|:|||       |:...|||..|        |...::  
pombe    76 CELKISSVYQSYSSTFNVSN-HVPSISKTVN-------IRETSKHLKHSTKAPKCSLPTSALE-- 130

  Fly   176 VSH----------------CD------------------------------MRFQGDK--SNQKC 192
            :.|                ||                              ..||.:|  .|...
pombe   131 IDHLNNFLHSSAKILDRALCDQSNQLFTDYTVKKKSKKNKSQLEENGLNHLFTFQDEKITLNSVV 195

  Fly   193 NS----------------------------YIWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLV 229
            ||                            .:|.....|.|...|:.:......:.:...|..:.
pombe   196 NSISYSSFFEELLITSYAKPKEALRTRGLAIVWNQRWKNSPESVLKARSEITVCKPSPFHPQLIA 260

  Fly   230 SGMYNGQVAAWDTRHGKLPV----MISEREVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDT 290
            .|.|||||..||.|.|:.||    :||..   |.:||..:.:.|:.......:..:||.|..|:.
pombe   261 GGAYNGQVFLWDLRQGQYPVSFTTIISGG---HLEPVTDITYINNPPSNNIVTCSTDGLVHIWEP 322

  Fly   291 RKLTEPLDRL-LMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKI 354
            ...:.|.:.: |...|.|..|.:.    .:.|.:.......|:.|.|.|.|....|...:.|:.:
pombe   323 DMFSRPSETICLSSQVDSSSQCIP----ATCLSFIPENNMEFLVGAEDGKLQRGYRSDYSETKAV 383

  Fly   355 QIRMMCHLG------PVYAITRNPAFV-----KNFLTVG--DWCARIW-------------SEDC 393
            |...:.:.|      .:..:|.|...|     |:|....  ||..|:|             |.|.
pombe   384 QPSNVSYEGHNVFISGIDVMTSNSQNVFLEKNKDFALTSSFDWTVRLWQCSPSRNQHELVPSNDL 448

  Fly   394 RESSII---WTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTVKVCDEPLYC 455
            .|..||   .|.:..:|:.|..|..::...|......|.|:.|||.:....||.:.....:||..
pombe   449 DEQVIINSCKTFTHKAMVFDVKWCVSEPCCFASVDALGNLNLWDLQKDVEAPVTSDIPDGKPLNK 513

  Fly   456 VRTNENGKFVSCGSQLGATFLVE-VSDNM 483
            :......:.::||...|...:.: :|.|:
pombe   514 IAWQPEKRNLACGGLNGNVHIYKHLSPNL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 88/440 (20%)
WD40 repeat 162..208 CDD:293791 17/129 (13%)
WD40 212..469 CDD:295369 67/290 (23%)
WD40 repeat 215..254 CDD:293791 15/42 (36%)
WD40 repeat 262..304 CDD:293791 8/42 (19%)
WD40 repeat 318..355 CDD:293791 8/36 (22%)
WD40 repeat 365..401 CDD:293791 14/58 (24%)
WD40 repeat 408..433 CDD:293791 5/24 (21%)
dic1NP_001342791.1 WD40 223..536 CDD:330360 73/319 (23%)
WD40 repeat 247..289 CDD:293791 15/41 (37%)
WD40 repeat 294..339 CDD:293791 8/44 (18%)
WD40 repeat 348..390 CDD:293791 9/41 (22%)
WD40 repeat 397..453 CDD:293791 12/55 (22%)
WD40 repeat 466..504 CDD:293791 10/37 (27%)
WD40 repeat 511..535 CDD:293791 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.