DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and dnai1.1

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021324725.1 Gene:dnai1.1 / 570363 ZFINID:ZDB-GENE-040910-7 Length:105 Species:Danio rerio


Alignment Length:78 Identity:17/78 - (21%)
Similarity:36/78 - (46%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 KVSQFFITRM---DGVLDTWDLLQQQNEPVLTVKVCDEPLYCVRTNENGKFVSCGSQLGATFLVE 478
            |....|::::   |..::.::.|.||.  |::.|   ..|.|:..|.....:..|:..|....::
Zfish    10 KAPSLFVSQVHVFDLSINRFEALCQQR--VVSTK---RHLTCIEFNPVHPIIIVGNDRGRVISLK 69

  Fly   479 VSDNMVMSAKNDK 491
            :|.|:..:.|.:|
Zfish    70 LSPNLRKNPKEEK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 14/67 (21%)
WD40 repeat 162..208 CDD:293791
WD40 212..469 CDD:295369 11/54 (20%)
WD40 repeat 215..254 CDD:293791
WD40 repeat 262..304 CDD:293791
WD40 repeat 318..355 CDD:293791
WD40 repeat 365..401 CDD:293791
WD40 repeat 408..433 CDD:293791 3/18 (17%)
dnai1.1XP_021324725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.