DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and dnai4

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001018595.1 Gene:dnai4 / 553797 ZFINID:ZDB-GENE-050522-322 Length:778 Species:Danio rerio


Alignment Length:444 Identity:91/444 - (20%)
Similarity:163/444 - (36%) Gaps:99/444 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SLSVANT-ERATYKSTGITHNEGGWPKDINMHDPE-QTVRYKRKIEKDENYITQVMNLTKPMEHY 117
            ||||.:| ...:..||.|.......|.|   .:|: |.:....|:::|...:.:|          
Zfish   318 SLSVVSTVSTVSGSSTHIEKMACVLPLD---EEPDLQLILQSDKLKQDLALMERV---------- 369

  Fly   118 IHQNNAVNIYENYFENLDPAPLPEPCKSRTVNVYRDPNPIKVPVKHLSW---------------- 166
                    :..|.|:       |:....|.:.:..||:.:::.::..||                
Zfish   370 --------VLANVFQ-------PKLAAYRQLPIIEDPDCVQMVMEEESWTEQSKNSHCPFLERLW 419

  Fly   167 --------------------SPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEPFLTLEP 211
                                :||   .:||.:..:.|:...|...|   .|.::||..|......
Zfish   420 DFSCELTMGRNVTCMVWNKKNPD---LLAVGYGQVEFKNPNSGLVC---CWSLKNPTWPDRVFYC 478

  Fly   212 KVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMISEREVC---HRDPVNSVLWNNSKSG 273
            :.....|:::..:...|..|||:|.:|.::.:..: ...|::...|   |..||..:.|.:.:.|
Zfish   479 ESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSE-QTPITDSSDCANLHTSPVWQLTWIDHEDG 542

  Fly   274 TEFFSG------GSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRSYGISVL------EYETT 326
            .....|      .|||::..|...|..|     .:|.:|....||.....||.|      ::...
Zfish   543 LAADKGEILVSVSSDGRISKWIHYKSME-----CVDLMKLKIHDLQWKQHISSLTPGMCFDFHPN 602

  Fly   327 IPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTV-GDWCARIWS 390
            ....::.|||.|.:..|:   .:..|:.......|..|||.:|.:|.....||:. .||..::|.
Zfish   603 DSKIYLVGTEEGHIHKCS---SSYNEQYLDSYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWR 664

  Fly   391 EDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVL 444
            :|. :..::...|...::.|..|| ...:..|....:|.::.|||.....:|.|
Zfish   665 QDL-QIPVMGFTSGQRVVFDIMWS-PHCATVFGAVSEGKVEIWDLRVSSLDPTL 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 70/337 (21%)
WD40 repeat 162..208 CDD:293791 13/81 (16%)
WD40 212..469 CDD:295369 57/249 (23%)
WD40 repeat 215..254 CDD:293791 8/38 (21%)
WD40 repeat 262..304 CDD:293791 10/47 (21%)
WD40 repeat 318..355 CDD:293791 9/42 (21%)
WD40 repeat 365..401 CDD:293791 10/36 (28%)
WD40 repeat 408..433 CDD:293791 5/24 (21%)
dnai4NP_001018595.1 WD40 repeat 431..473 CDD:293791 10/47 (21%)
WD40 <459..754 CDD:225201 62/272 (23%)
WD 1. /evidence=ECO:0000255 477..517 7/40 (18%)
WD40 479..751 CDD:295369 57/249 (23%)
WD40 repeat 483..526 CDD:293791 9/43 (21%)
WD 2. /evidence=ECO:0000255 526..573 12/51 (24%)
WD40 repeat 531..576 CDD:293791 11/49 (22%)
WD 3. /evidence=ECO:0000255 586..629 9/45 (20%)
WD40 repeat 589..624 CDD:293791 7/37 (19%)
WD 4. /evidence=ECO:0000255 633..673 12/40 (30%)
WD40 repeat 638..675 CDD:293791 10/37 (27%)
WD 5. /evidence=ECO:0000255 676..715 9/39 (23%)
WD40 repeat 681..707 CDD:293791 6/26 (23%)
WD 6. /evidence=ECO:0000255 721..760
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.