DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and dync2i2

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_012823678.1 Gene:dync2i2 / 448417 XenbaseID:XB-GENE-953027 Length:503 Species:Xenopus tropicalis


Alignment Length:385 Identity:99/385 - (25%)
Similarity:157/385 - (40%) Gaps:52/385 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YRDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRF-QGDKSNQKCNSYI--WEVE----NPNEPFLT 208
            |.|....::.|..:||:..|.| :|.|:  .|| .||.|.:|  ||:  |.::    |.|.|...
 Frog   121 YPDALEQQLQVTSVSWNSTGSI-IACSY--GRFGDGDWSTEK--SYVCTWNLDRRGFNANNPDTV 180

  Fly   209 LEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMISEREV--CHRDPVNSVLWNNSK 271
            |:.....:||.::...|:.:..|::||.|..|||.....|::.....|  .|.|.|..|.|...|
 Frog   181 LDVPSSVMCLAWHPSQPSLIAGGLFNGDVLVWDTSRTDDPLIGRTGHVGDTHTDAVYQVGWMQEK 245

  Fly   272 S---GTEFFSGGSDGQVLWWDTRK-----LTE---------PLDRLLMDPVKSDDQDLSRSYGIS 319
            |   ..:.||..|||::|.|...|     |.:         |.:..:..|.:.|     .:.|::
 Frog   246 SQGHRHQVFSVSSDGKILVWQMEKEGHLVLLDGFALVAQQIPSNTKIHKPGRGD-----TAVGVT 305

  Fly   320 VLEYETTIPTRFMAGTEMGMLFSC----------NRKGKTPTE-KIQIRMMCHLGPVYAITRNPA 373
            .|.|....|:.|:.|.|.|.|..|          |.....|.. ..|.....|.||||::|.:|.
 Frog   306 CLSYSHFDPSLFIVGVEGGYLLKCSSSVQTLAPINMGSSVPLRAPAQFTFSPHGGPVYSVTCSPF 370

  Fly   374 FVKNFLTVG-DWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQ 437
            ....||:.| |..|.::|. .:...::..:.|...|....||..:...|.....||.:...|..:
 Frog   371 HRNLFLSAGTDGHAHLYSM-LQAKPLVSLQLSQKYLFSIRWSPVRPLVFAAASGDGEVVLVDFAK 434

  Fly   438 QQNEPVLTVK--VCDEPLYCVRTNE-NGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLL 494
            ...:|.|.:|  ....|:||:..|. ..:.::.|...|...:.::|.:.:.....:..||
 Frog   435 SFQKPSLCIKQTASGRPVYCLEFNHAQSQLLAAGDGTGTVKIWQLSSDFIEQRARETALL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 95/362 (26%)
WD40 repeat 162..208 CDD:293791 18/52 (35%)
WD40 212..469 CDD:295369 72/290 (25%)
WD40 repeat 215..254 CDD:293791 11/38 (29%)
WD40 repeat 262..304 CDD:293791 15/58 (26%)
WD40 repeat 318..355 CDD:293791 11/47 (23%)
WD40 repeat 365..401 CDD:293791 10/36 (28%)
WD40 repeat 408..433 CDD:293791 6/24 (25%)
dync2i2XP_012823678.1 WD40 repeat 131..182 CDD:293791 19/55 (35%)
WD40 184..481 CDD:392136 74/302 (25%)
WD40 repeat 188..227 CDD:293791 11/38 (29%)
WD40 repeat 236..297 CDD:293791 16/60 (27%)
WD40 repeat 305..355 CDD:293791 12/49 (24%)
WD40 repeat 362..399 CDD:293791 10/37 (27%)
WD40 repeat 405..446 CDD:293791 10/40 (25%)
WD40 repeat 452..477 CDD:293791 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.