DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and sw

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_477075.2 Gene:sw / 44160 FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster


Alignment Length:444 Identity:104/444 - (23%)
Similarity:188/444 - (42%) Gaps:69/444 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPL-PEPC 143
            |::|....||    |:.|...||:...|:...:.:|..:.:|  |:||.:|....|.... .|..
  Fly   237 KEVNELSEEQ----KQMIILSENFQRFVVRAGRVIERALSEN--VDIYTDYIGGGDSEEANDERS 295

  Fly   144 KSR-TVN-VYRDPNPIKVP-VKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEP 205
            .:| ::| |:.|....|.. :..:.||         :|......|...|.:        |:||||
  Fly   296 HARLSLNRVFYDERWSKNRCITSMDWS---------THFPELVVGSYHNNE--------ESPNEP 343

  Fly   206 ----------FLTLEPK--------VPCVCLEYNQKDPTSLVSGMYNGQVAAWDTR-HGKLPVMI 251
                      |....|:        |...|  :.:.:|..::.|.|:||:..||.| ..:.|:..
  Fly   344 DGVVMVWNTKFKKSTPEDVFHCQSAVMSTC--FAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQR 406

  Fly   252 SE-REVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRS 315
            :. ....|..||..:....:::.....|..|||::..|....|::|.|.|.:      .|..|::
  Fly   407 TPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLEL------QQRQSKA 465

  Fly   316 YGISVLEYETTIPTRFMAGTEMGMLFSCNRKG-KTPTEKIQIRMMCHLGPVYAITR-----NPAF 374
            ..|:.:.:........:.|:|.|.::|.:|.| ::...::..|   ||||:..|:.     :|.|
  Fly   466 IAITSMAFPANEINSLVMGSEDGYVYSASRHGLRSGVNEVYER---HLGPITGISTHYNQLSPDF 527

  Fly   375 VKNFLTVG-DWCARIWSEDCRESSIIWT-KSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQ 437
            ...|||.. ||..::||  .:::..::: :.:|..:.|.|||....:.|......|.||.|:|.|
  Fly   528 GHLFLTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNLNQ 590

  Fly   438 QQNEPVLTVKVCDEP-LYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKND 490
            ....|..::.|...| |..|....:|..|..|.:.|..::.:|::|:...::::
  Fly   591 DTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 81/351 (23%)
WD40 repeat 162..208 CDD:293791 11/55 (20%)
WD40 212..469 CDD:295369 66/275 (24%)
WD40 repeat 215..254 CDD:293791 10/40 (25%)
WD40 repeat 262..304 CDD:293791 10/41 (24%)
WD40 repeat 318..355 CDD:293791 7/37 (19%)
WD40 repeat 365..401 CDD:293791 10/41 (24%)
WD40 repeat 408..433 CDD:293791 8/24 (33%)
swNP_477075.2 Dynein_IC2 107..135 CDD:402922
WD40 316..632 CDD:421866 80/345 (23%)
WD40 repeat 316..365 CDD:293791 12/65 (18%)
WD40 repeat 371..409 CDD:293791 10/39 (26%)
WD40 repeat 418..457 CDD:293791 9/38 (24%)
WD40 repeat 469..555 CDD:293791 21/90 (23%)
WD40 repeat 561..599 CDD:293791 12/37 (32%)
WD40 repeat 607..633 CDD:293791 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.