DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and CG13930

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_647645.1 Gene:CG13930 / 38210 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster


Alignment Length:602 Identity:134/602 - (22%)
Similarity:226/602 - (37%) Gaps:145/602 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ERRSFGARVHFEDKDEVVFTENSNPELVK-SYILKNPVDRVTQYAGQTSL---SVANTERATYKS 68
            ||||..|....|:..:|:.......||:. :...:..||..||  ..|:|   .:.||||.|   
  Fly   118 ERRSMTALADTEEGRQVMEDNRKYDELLSGTDKTRRTVDADTQ--TMTALMKSRLVNTERLT--- 177

  Fly    69 TGITHNEGGWPKDINMHDP----EQT-----VRYKRKIEKDENYITQV-----------MNLTKP 113
               |...|.:..:..|:|.    |::     |:..:|:|....::..|           ..|...
  Fly   178 ---TAQMGSYVSNFEMYDTYTDLEKSTTSVQVQGAKKMEITTYHVGGVDQFVGINCLPGFRLALM 239

  Fly   114 MEHYIHQNNAVNIYENYFENL-DPAPLPEPCKSRTVNVYR------------DPNPIKVPVKHLS 165
            :...|..:|.....:..:.|: .|.||.|..|.:    ||            ||. :...|..:|
  Fly   240 LTMRILASNVFEPQQRRYRNMAPPDPLAEDVKFK----YRLGLLWRLSPPSSDPK-VHQAVSDMS 299

  Fly   166 WSPDGGIKMAVSHCDMRFQGDKSNQKCNS-------YIWEVENPNEPFLTLEPKVPCVCLEYNQK 223
            :.|..|..|||::      |..|:.|.:.       |:|.::||..|......:||.|.:|::..
  Fly   300 FCPSNGDIMAVAY------GVYSHGKVSKLPRSGWVYVWNIKNPVNPERRYHYQVPVVTVEFSPT 358

  Fly   224 DPTSLVSGMYNGQVAAWDTRHGKL-PVMISER-EVCHRDPVNSVLWNNSKSG--------TEFFS 278
            .|..|..|::||.|...|.....| |:.:|:| ...:.:||.::.|...:..        |.|.:
  Fly   359 QPQLLAIGLHNGGVEVRDISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDVGCRNPHITPFLA 423

  Fly   279 GGSDGQV-----------LWWDTRKLTE--------PLDR-----------------LLMDPVKS 307
            ....|.|           |..:.::|..        |::|                 :::|||:|
  Fly   424 TSQAGAVTKYRLINSPNMLGLEQQRLQRAEGELEGIPIERQPPAASLLANRHPQCLEIVLDPVQS 488

  Fly   308 DDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHLGPVYAITRNP 372
            |                     .:...|:.|.|:.|:.  ..|.:.:::|.: |.||...:..:|
  Fly   489 D---------------------IYYVLTDEGTLYKCST--NYPLQHLELRQV-HDGPAACMEFSP 529

  Fly   373 AFVKNFLTVG-DWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLL 436
            ...:.:||.| |||.|||..... ..|:..:...|.:....||.|. |...::.....:|.|||.
  Fly   530 WSPRMYLTCGSDWCIRIWLAGIL-LPIVTLQHHLSPVHCARWSRTH-STILVSLSRSTVDIWDLR 592

  Fly   437 QQQNEPVLTVKVCDEPLYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLLTAMFERE 501
            ....:||.:..:..:..|     ...||..||..|.   :...:.|::|.:..|.| ....|:.:
  Fly   593 NSTMKPVSSTVIDADIFY-----TTFKFTHCGRSLA---VGNEAGNLLMLSFEDMP-FPPHFQYK 648

  Fly   502 NRREKILEAKSRESKLK 518
            ..:..|.:|.|.:..|:
  Fly   649 QLKRAIFKALSMQPDLR 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 83/375 (22%)
WD40 repeat 162..208 CDD:293791 14/52 (27%)
WD40 212..469 CDD:295369 66/303 (22%)
WD40 repeat 215..254 CDD:293791 12/39 (31%)
WD40 repeat 262..304 CDD:293791 10/85 (12%)
WD40 repeat 318..355 CDD:293791 5/36 (14%)
WD40 repeat 365..401 CDD:293791 11/36 (31%)
WD40 repeat 408..433 CDD:293791 5/24 (21%)
CG13930NP_647645.1 WD40 <279..648 CDD:225201 90/410 (22%)
WD40 repeat 295..344 CDD:293791 15/54 (28%)
WD40 repeat 350..397 CDD:293791 13/46 (28%)
WD40 repeat 400..473 CDD:293791 9/72 (13%)
WD40 repeat 478..513 CDD:293791 10/57 (18%)
WD40 <518..>593 CDD:295369 23/76 (30%)
WD40 repeat 524..560 CDD:293791 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.