DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and CG15701

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_611100.1 Gene:CG15701 / 36801 FlyBaseID:FBgn0034095 Length:1051 Species:Drosophila melanogaster


Alignment Length:476 Identity:92/476 - (19%)
Similarity:161/476 - (33%) Gaps:133/476 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 APLPEPCKSRTVNVYRDPNPIKVPVKHLSWSP-DGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVE 200
            :|...|.::..:|.        :||:.:..|. :|.:.:.|..|.......|.:......:|.:.
  Fly   543 SPRNVPLQTGLLNA--------LPVRRIFGSAGNGQLVVTVHECPADSNVYKEDFASLLMVWSLA 599

  Fly   201 NPNEP--FLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMISEREVCHRDPVN 263
            ||::|  .|:...:|..|.|....:|  .:|:|:.:|.||.||.|.                   
  Fly   600 NPSQPLRLLSTWAEVSRVALSAQAQD--IVVAGLRDGSVAMWDLRE------------------- 643

  Fly   264 SVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRSYG--ISVLEYETT 326
                      |..:....||.:..:...:...|:      |.:.|.:..:...|  :.|..:.:.
  Fly   644 ----------THSYCSKLDGHLTHFAATQSVVPM------PEQQDKEVNAMDLGAVVDVRSFRSH 692

  Fly   327 IPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVGDWCARIWSE 391
            :....:|.|. |:        :|..:::|          ||...:    ...||:........|.
  Fly   693 LNAGGVAATS-GL--------QTTYKEVQ----------YASLND----SGLLTMWTLVEGASST 734

  Fly   392 DCRESSIIWTK----SSSS----------MLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNE- 441
            :..|.|..|.:    .|.|          :|.....:|.|....|    .|.:.:.|:|::.|: 
  Fly   735 NSNEFSSPWARVKLLQSGSCDLRSYLERRLLKSHQSAYEKTKSLF----QGNIYSDDVLRELNDT 795

  Fly   442 PVLTVKVCDEPLYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLLTAMFERENRREK 506
            ..||..:..:.|..:|...    :..||:|   ..|..:.|.|:..  .:.|.|..|.|      
  Fly   796 QTLTTALQGQGLQGLRFTS----IDTGSEL---IYVCTNRNFVLCC--TRSLKTERFAR------ 845

  Fly   507 ILEAKSR---ESKLKVKANH-----GQDQGDTMMVNGKINMAPFEAACEQAASEYFAAVEQERQR 563
            |...:||   .:.|.|.:|.     |...|..|::|           |.|...:     .|..|:
  Fly   846 IAVNESRFLFPTSLCVLSNENYVAVGLSNGSVMILN-----------CNQRQRQ-----RQRNQQ 894

  Fly   564 RLPGGKQDAEEADVSEAESSK 584
            |...|...|  .|..:.|:.|
  Fly   895 RPKTGLPPA--TDEPDPETGK 913

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 63/341 (18%)
WD40 repeat 162..208 CDD:293791 9/48 (19%)
WD40 212..469 CDD:295369 47/273 (17%)
WD40 repeat 215..254 CDD:293791 11/38 (29%)
WD40 repeat 262..304 CDD:293791 4/41 (10%)
WD40 repeat 318..355 CDD:293791 5/36 (14%)
WD40 repeat 365..401 CDD:293791 7/35 (20%)
WD40 repeat 408..433 CDD:293791 5/24 (21%)
CG15701NP_611100.1 PTZ00108 <23..270 CDD:240271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.