DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and DNAI1

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001268357.1 Gene:DNAI1 / 27019 HGNCID:2954 Length:703 Species:Homo sapiens


Alignment Length:594 Identity:120/594 - (20%)
Similarity:209/594 - (35%) Gaps:152/594 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GARVHFEDKDEVVFTENSNPELVKSYIL---------KNPVDRVTQYAGQTSLSVAN-------- 60
            |.|.|:.| :.|..:...:.|.||  ::         :.|.:..|:...||.:..|.        
Human   118 GRRQHYRD-ELVAVSYQGSQESVK--VISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEE 179

  Fly    61 -------------------TERA--TYKS--------------TGITHNEGGWP-KDINMHDPEQ 89
                               :|||  ||.:              |..:.....|. .|..:.:.|:
Human   180 ELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEK 244

  Fly    90 TVRYKRK---------------------IEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFEN 133
            ..:.|.|                     :|...:.:.::....|.||..::||...:|.:: |:.
Human   245 QEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQD-FKY 308

  Fly   134 LDPAPLPEPCKSRTVNVYRDPNPIKVPV--------KHLS-----WSPDGGIKMAVSHCDMRFQG 185
            .|.|          .:.|||.....:|:        |.||     |:|......||.:....|. 
Human   309 YDDA----------ADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFM- 362

  Fly   186 DKSNQKCNSYIWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTR--HGKLP 248
              ...:....::.::||:.|..........:||:.:...|..:..|.|:|.||.::.:  |.:..
Human   363 --KQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPS 425

  Fly   249 VMISEREVCHRDPVNSVLW--NNSKSGTEFFSGGSDGQVLWW----------DTRKL------TE 295
            ...|.:...|.|||..|.|  ::......|||..|||:::.|          |..||      ||
Human   426 FCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTE 490

  Fly   296 PLDRLLMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMC 360
            ..:.|.:.||...          :..::...|...|:.|||.|.::.|:   |:.:.:.......
Human   491 VPEGLQLHPVGCG----------TAFDFHKEIDYMFLVGTEEGKIYKCS---KSYSSQFLDTYDA 542

  Fly   361 HLGPVYAITRNPAFVKNFLTV-GDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFIT 424
            |...|..::.||...|.|::. .||..:||....:....|:..:|:  :.|.||:....:.|...
Human   543 HNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSA--VGDVAWAPYSSTVFAAV 605

  Fly   425 RMDGVLDTWDLLQQQNEPVLTVKVCDEP-------LYCVRTNENGKFVSCGSQLGATFLVEVSDN 482
            ..||....:||...:.|     .:|::|       |..|:.|.....:..|...|....:::|.|
Human   606 TTDGKAHIFDLAINKYE-----AICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPN 665

  Fly   483 MVMSAKNDK 491
            :....|..|
Human   666 LRKMPKEKK 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 80/362 (22%)
WD40 repeat 162..208 CDD:293791 11/50 (22%)
WD40 212..469 CDD:295369 65/284 (23%)
WD40 repeat 215..254 CDD:293791 10/40 (25%)
WD40 repeat 262..304 CDD:293791 16/59 (27%)
WD40 repeat 318..355 CDD:293791 8/36 (22%)
WD40 repeat 365..401 CDD:293791 10/36 (28%)
WD40 repeat 408..433 CDD:293791 6/24 (25%)
DNAI1NP_001268357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..174 5/29 (17%)
WD40 324..681 CDD:225201 83/374 (22%)
WD 1 324..374 9/52 (17%)
WD40 repeat 339..385 CDD:293791 8/48 (17%)
WD40 <357..615 CDD:295369 61/275 (22%)
WD 2 379..417 9/37 (24%)
WD40 repeat 391..428 CDD:293791 9/36 (25%)
WD 3 426..469 14/42 (33%)
WD40 repeat 439..496 CDD:293791 15/56 (27%)
WD 4 478..530 15/64 (23%)
WD40 repeat 504..541 CDD:293791 8/39 (21%)
WD 5 535..574 10/38 (26%)
WD40 repeat 547..584 CDD:293791 10/36 (28%)
WD 6 578..616 8/39 (21%)
WD40 repeat 589..616 CDD:293791 6/26 (23%)
WD 7 622..662 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.