DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnai2 and SdicA

DIOPT Version :9

Sequence 1:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001303576.1 Gene:SdicA / 26067074 FlyBaseID:FBgn0283432 Length:533 Species:Drosophila melanogaster


Alignment Length:444 Identity:104/444 - (23%)
Similarity:189/444 - (42%) Gaps:69/444 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPL-PEPC 143
            |::|....||    |:.|...||:...|:...:.:|..:.:|  |:||.:|....|.... .|..
  Fly   117 KEVNELSEEQ----KQMIILSENFQRFVVRAGRVIERALSEN--VDIYTDYIGGGDSEEANDERS 175

  Fly   144 KSR-TVN-VYRDPNPIKVP-VKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEP 205
            .:| ::| |:.|....|.. :..:.||         :|......|...|.:        |:||||
  Fly   176 HARLSLNRVFYDERWSKNRCITSMDWS---------THFPELVVGSYHNNE--------ESPNEP 223

  Fly   206 ----------FLTLEPK--------VPCVCLEYNQKDPTSLVSGMYNGQVAAWDTR-HGKLPVMI 251
                      |....|:        |...|  :.:.:|..::.|.|:||:..||.| ..:.|:..
  Fly   224 DGVVMVWNTKFKKSTPEDVFHCQSAVMSTC--FAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQR 286

  Fly   252 SE-REVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRS 315
            :. ....|..||..:....:::.....|..|||::..|....|::|.|.|.:      .|..|::
  Fly   287 TPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLEL------QQRQSKA 345

  Fly   316 YGISVLEYETTIPTRFMAGTEMGMLFSCNRKG-KTPTEKIQIRMMCHLGPVYAITR-----NPAF 374
            ..|:.:.:........:.|:|.|.::|.:|.| ::...::..|   ||||:..|:.     :|.|
  Fly   346 IAITSMAFPANEINSLVMGSEDGYVYSASRHGLRSGVNEVYER---HLGPITGISTHYNQLSPDF 407

  Fly   375 VKNFLTVG-DWCARIWSEDCRESSIIWT-KSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQ 437
            ...|||.. ||..::||  .:::..::: :.:|..:.|.|||....:.|......|.||.|:|.|
  Fly   408 GHLFLTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNLNQ 470

  Fly   438 QQNEPVLTVKVCDEP-LYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKND 490
            ....|:.::.|...| |..|....:|..|..|.:.|..::.:|::|:...::::
  Fly   471 DTEVPIASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 81/351 (23%)
WD40 repeat 162..208 CDD:293791 11/55 (20%)
WD40 212..469 CDD:295369 66/275 (24%)
WD40 repeat 215..254 CDD:293791 10/40 (25%)
WD40 repeat 262..304 CDD:293791 10/41 (24%)
WD40 repeat 318..355 CDD:293791 7/37 (19%)
WD40 repeat 365..401 CDD:293791 10/41 (24%)
WD40 repeat 408..433 CDD:293791 8/24 (33%)
SdicANP_001303576.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 17/66 (26%)
WD40 196..512 CDD:295369 80/345 (23%)
WD40 repeat 196..245 CDD:293791 12/65 (18%)
WD40 <224..523 CDD:225201 72/311 (23%)
WD40 repeat 251..289 CDD:293791 10/39 (26%)
WD40 repeat 298..337 CDD:293791 9/38 (24%)
WD40 repeat 349..435 CDD:293791 21/90 (23%)
WD40 repeat 441..479 CDD:293791 12/37 (32%)
WD40 repeat 487..513 CDD:293791 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.