| Sequence 1: | NP_001261723.1 | Gene: | Dnai2 / 39318 | FlyBaseID: | FBgn0036195 | Length: | 585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_319777.5 | Gene: | LOC1279985 / 1279985 | VectorBaseID: | AGAMI1_006308 | Length: | 745 | Species: | Anopheles gambiae |
| Alignment Length: | 31 | Identity: | 9/31 - (29%) |
|---|---|---|---|
| Similarity: | 15/31 - (48%) | Gaps: | 6/31 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 PTIVASSSEEVSSLEWEEIAMAQEEEDLICR 44 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dnai2 | NP_001261723.1 | WD40 | 212..469 | CDD:475233 | |
| WD40 repeat | 215..254 | CDD:293791 | |||
| WD40 repeat | 262..304 | CDD:293791 | |||
| WD40 repeat | 318..355 | CDD:293791 | |||
| WD40 repeat | 365..401 | CDD:293791 | |||
| WD40 repeat | 408..433 | CDD:293791 | |||
| WD40 repeat | 162..208 | CDD:293791 | |||
| LOC1279985 | XP_319777.5 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||