DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and THAP7

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001008695.1 Gene:THAP7 / 80764 HGNCID:23190 Length:309 Species:Homo sapiens


Alignment Length:143 Identity:35/143 - (24%)
Similarity:61/143 - (42%) Gaps:29/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFPKEKPNLQR--WIDFCQRDNINPTTACI----------CNEH 55
            |:...|...:....|.:...||...:|.|.:|  |:..|||  ::|:...:          |::|
Human     5 CSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQR--LDPSGQGLWDPASEYIYFCSKH 67

  Fly    56 FAPNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMSNIG 120
            |..:.||.     :|.|..:  :||.|:.|::.  :..:| ||.:.|....|.| .|..::|.: 
Human    68 FEEDCFEL-----VGISGYH--RLKEGAVPTIF--ESFSK-LRRTTKTKGHSYP-PGPAEVSRL- 120

  Fly   121 FDPHHAGTQSSEG 133
               .....:.|||
Human   121 ---RRCRKRCSEG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 24/96 (25%)
GrpE 198..>239 CDD:295646
THAP7NP_001008695.1 THAP 4..93 CDD:214951 24/96 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..209
HCFC1-binding motif (HBM). /evidence=ECO:0000250 229..232
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.