DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and zgc:158320

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001073126.1 Gene:zgc:158320 / 780837 ZFINID:ZDB-GENE-061201-33 Length:292 Species:Danio rerio


Alignment Length:274 Identity:58/274 - (21%)
Similarity:91/274 - (33%) Gaps:87/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRCAVKNCGN--------NNRIANRTKWRYFHFPKEKP-NLQRWIDFCQRDNINPTTAC----IC 52
            :.||...|.|        :|..::..|..:..||..:| .|..|......|...|..:.    ||
Zfish     3 LNCAYPGCLNLFKKERLRSNSSSHGGKLTFHRFPTLEPGRLLLWRAALGMDPDTPMRSLRVWRIC 67

  Fly    53 NEHFAPNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMS 117
            :|||:|.||.                       :|||.:.|   |:.|......|.|..||...|
Zfish    68 SEHFSPEDFR-----------------------AVNGNKVL---LKASAVPRVYSTPAPGSRAES 106

  Fly   118 NIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEGFEE----------------------AEDDDCP 160
                      .|:.:..:..|.:|  ..::.||..|                      ::.::.|
Zfish   107 ----------AQAMQDCKEEETEL--LVSEAEGVSESRPQLHHSYTLPAAQSMHADEPSKREEHP 159

  Fly   161 SGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVK----HLELEICSLKREVFFLKDEYQKIKA 221
            .|...:.:..|...:|  :|||.|      |..|..    |......:...|...|| |.|.|.:
Zfish   160 EGRPDLNIIKLPSCSP--SAKDGV------GFPYTSRPAAHTHTAAAAGSSEKLVLK-ERQWIVS 215

  Fly   222 EMRNLKDTIKRSEE 235
            | .::.|..:|.::
Zfish   216 E-SSVMDLFRRCQQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 21/98 (21%)
GrpE 198..>239 CDD:295646 9/38 (24%)
zgc:158320NP_001073126.1 THAP 5..96 CDD:214951 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46600
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.