DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and thap1

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001038749.1 Gene:thap1 / 692315 ZFINID:ZDB-GENE-060519-9 Length:158 Species:Danio rerio


Alignment Length:88 Identity:23/88 - (26%)
Similarity:38/88 - (43%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKNC---GNNNRIANRTKWRYFHFPKEKPNL-QRWIDFCQRDNINPTT-ACICNEHFAPNDFERN 64
            |::|   |..||........:..||..:|.: .:|:....|.|..||. :.||::||..:.|::.
Zfish     2 VQSCSAYGCKNRYQKDRNISFHKFPLARPEVCVQWVSAMSRRNFKPTKYSNICSQHFTSDCFKQE 66

  Fly    65 MQYELGFSRKNPTKLKPGSFPSV 87
            .         |...||..:.||:
Zfish    67 C---------NNRVLKDNAVPSL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 23/88 (26%)
GrpE 198..>239 CDD:295646
thap1NP_001038749.1 THAP 4..81 CDD:214951 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46600
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.