DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and Thap11

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_067488.1 Gene:Thap11 / 59016 MGIID:1930964 Length:305 Species:Mus musculus


Alignment Length:302 Identity:62/302 - (20%)
Similarity:101/302 - (33%) Gaps:115/302 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFH-FPKEKPNLQRWIDFCQRDNIN-------PTTA-CICNEHFAP 58
            |.|..|.||   ::|.|..:|: |||:....:.|:....|..::       |||. .:|:.||..
Mouse     6 CCVPGCYNN---SHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQG 67

  Fly    59 NDFERNMQYELGFSRKNPTKLKPGSFP--SVNGPQKLAKELRGSI-------------------- 101
                         .||..|...|..||  .|| .:|:|:...|:.                    
Mouse    68 -------------GRKTYTVRVPTIFPLRGVN-ERKVARRPAGAAAARRRQQQQQQQQQQQQQQQ 118

  Fly   102 ---KRGSKSVPLAGSTKMS--------------NIGFDPHHA--------GTQSSEGHE----TI 137
               ::.|.|...|.:|::.              ....|.:.|        .|.|.:..:    |:
Mouse   119 LQQQQPSPSSSTAQTTQLQPNLVSASAAVLLTLQAAVDSNQAPGSVVPVSTTPSGDDVKPIDLTV 183

  Fly   138 EIQLCGFN--------TDIE----GFEEAEDDDCPSGPRLV-----------------------E 167
            :::.....        :::|    |.|.||   |..||:||                       |
Mouse   184 QVEFAAAEGAAAAAAASELEAATAGLEAAE---CTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTE 245

  Fly   168 VEILDPLNPQSNAKDHVEIIDSEGDSYVKHLELEICSLKREV 209
            .|:|..||.|.:....:|:...|....::||.|....|:.|:
Mouse   246 EELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREEL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 25/95 (26%)
GrpE 198..>239 CDD:295646 4/12 (33%)
Thap11NP_067488.1 THAP 5..81 CDD:283206 23/90 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..135 8/50 (16%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 234..237 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.