DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and AgaP_AGAP007257

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_001687980.1 Gene:AgaP_AGAP007257 / 5666931 VectorBaseID:AGAP007257 Length:398 Species:Anopheles gambiae


Alignment Length:98 Identity:33/98 - (33%)
Similarity:46/98 - (46%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWR-YFHFPKEKPNLQRWIDFCQR-------DNINP----TTACICNEH 55
            |.|..| .|.::.|:...| ||.||::....::|:|||.|       |...|    .::.||::|
Mosquito     9 CLVLGC-RNRQLLNQANIRSYFRFPRDADLCKKWVDFCNRPELYKKYDENGPEYLYKSSRICSDH 72

  Fly    56 FAPNDFERNMQYELGFSRKNPTKLKPGSFPSVN 88
            |.|.||.....:..|        ||.||.||||
Mosquito    73 FQPADFNNPNLFSQG--------LKKGSVPSVN 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 31/96 (32%)
GrpE 198..>239 CDD:295646
AgaP_AGAP007257XP_001687980.1 THAP 8..98 CDD:283206 33/98 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I18739
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.